KEGG   Saccharomyces cerevisiae (budding yeast): YPL001WHelp
Entry
YPL001W           CDS       T00005                                 

Gene name
HAT1, KAT1
Definition
(RefSeq) histone acetyltransferase catalytic subunit HAT1
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YPL001W (HAT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YPL001W (HAT1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    YPL001W (HAT1)
   HAT complexes
    HATB complex
     YPL001W (HAT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_10 Botulinum_HA-17 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 856106
NCBI-ProteinID: NP_015324
SGD: S000005922
UniProt: Q12341
Structure
PDB: 

Position
XVI:554605..555729
Genome map
AA seq 374 aa AA seqDB search
MSANDFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDS
VTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDV
FEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLL
NKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAII
QSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSL
KLEERQFNRLVEMLLLLNNSPSFELKVKNRLYIKNYDALDQTDPEKAREALQNSFILVKD
DYRRIIESINKSQG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaatgatttcaagcctgaaacgtggacttcaagcgccaacgaagccttaaga
gtttctatagttggagaaaacgctgttcagttttcaccattattcacgtatccaatttac
ggtgactccgaaaagatctacggctataaggatctcatcatccacctagcatttgattca
gtaacattcaagccgtatgttaacgtcaagtattcagcaaaattaggagacgacaatatt
gtagacgtggaaaaaaaattactctcatttctaccaaaggatgatgtaattgttagggat
gaagctaaatgggtagattgctttgcagaagaacgaaaaacacataatttatctgatgtt
tttgaaaaagtatcagagtattcgttgaatggggaagaatttgttgtatataaatcgagt
ttggttgacgattttgccaggagaatgcatcgtcgtgttcaaatcttttcattacttttt
atcgaagccgctaactatatagatgagactgacccgagttggcaaatctattggttgttg
aacaagaaaacaaaagaattgattggtttcgtcactacttacaagtattggcactacctt
ggagcaaaatctttcgatgaggatatagataaaaaattcagagccaaaatatctcaattt
ctgatctttccaccttatcaaaataaaggccacggatcctgtctttatgaggctataatc
caatcttggctagaagacaaaagtattactgaaattactgtagaggatccaaacgaagca
tttgacgatcttcgcgacaggaatgatattcaaagactgcgaaaacttggttatgatgct
gtctttcagaagcactccgacctttctgatgagtttttggagtcaagccgaaaatcttta
aaactggaagaaagacagtttaatcgtcttgtggaaatgcttcttcttttaaacaattct
ccatcatttgaattaaaggtaaagaataggttgtacattaaaaattatgatgccctagat
caaactgatccagaaaaggcaagagaagctttacaaaattcatttattttagtcaaagat
gattataggcgtattatagagtcgataaataaatctcaaggttaa

DBGET integrated database retrieval system