KEGG   Saccharomyces cerevisiae (budding yeast): YPL003WHelp
Entry
YPL003W           CDS       T00005                                 

Gene name
ULA1, ENR2
Definition
(RefSeq) Ula1p
  KO
K04532  amyloid beta precursor protein binding protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YPL003W (ULA1)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   YPL003W (ULA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF
Motif
Other DBs
NCBI-GeneID: 856104
NCBI-ProteinID: NP_015322
SGD: S000005924
UniProt: Q12059
Position
XVI:552020..553408
Genome map
AA seq 462 aa AA seqDB search
MERYDRQLRLWGALGQDSLNRSRVCVVGPATPLLQEVFKNLVLAGISSLTWLKVECAVQS
GSLFLAELKKDLEPLASKQLEYEENDLRKTLQQPQYDWTRFSVVILTCIGEQTAMLDLNE
IRRQRGTKFPPVLNTFVSGFYGYIYLVLSETHFVLQAHPDSKKYDLRLQNPWPELINYVD
TFDLSKMDTATFSGIPYTVLLMKCIAKLERDGNNGRITIDQMKKVLDQICLPLGNDVIYE
PNYVEAKRYAYLACSQNDCCKELEDLLRNLEISDYGNDWHDTYNYEILTLLLTLKNIAKE
NGELSFQPLTGTLPDMESTTENYIRLKKLYEVKAKLDKSRVEESLARSKKIVSQDVLETF
CSHYGEVRKILPPKSDLLGIFSTSNALLDALVMVQFWEQPAVTAEDKDEFIGLRVDDNYS
VMAFFGGAVVQEAIKLITHHYVPIDNLFLYNGINNSSATYKI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatatgatagacagctgagactatggggagcattgggccaagatagtttgaac
cggtcccgtgtgtgcgtggtaggacctgctacacctttgctgcaggaagtttttaagaat
ctggtgcttgccggaatatcatctcttacttggctcaaagtagagtgtgcagttcaatcg
ggttctctgtttttagcagagcttaaaaaagatcttgagccattggcttctaaacagcta
gaatatgaggaaaatgaccttagaaagacgttacagcaacctcagtatgattggacccgc
ttctcggtggtgatcttgacttgtattggtgagcaaactgcgatgctcgatttaaatgag
attaggcggcagagaggaacaaagtttccgcctgttctaaacactttcgtctctggattt
tatggatatatatatctggtactctcagaaacacattttgttttgcaagcacacccagat
agtaagaagtatgatttacggttacagaacccttggcctgaactaataaattacgtagat
acatttgacctaagtaaaatggatacagccacgttttctggtattccatatactgttttg
ctcatgaagtgtattgcaaaacttgaaagggatggtaataatgggaggataacgattgat
cagatgaagaaagttttagaccaaatttgccttcctttagggaatgatgttatctacgaa
cccaattatgtggaagctaaacgctatgcttacttggcctgctctcaaaatgattgttgt
aaagaactggaagatctgctccgaaatttggaaatatcagattatgggaacgattggcat
gatacttataactacgagattctcacactattattgactttgaaaaatattgctaaagag
aatggggagctcagctttcaacctttaacgggcactctcccagatatggagtcaacaacg
gaaaattatatcagactcaagaaactgtatgaagtaaaagcaaagcttgacaagtctcgt
gtggaggaaagtttggctcgcagtaaaaaaatagtttcacaggatgtcttggagacattt
tgttctcattacggggaggtcaggaaaatattgccgccaaaaagtgacttgttaggtatt
tttagcacctcgaatgcccttttagatgcattagttatggtccaattctgggagcaaccg
gcagtaactgcagaggataaagatgagtttattggtttacgagtcgacgataactattcc
gtaatggccttttttggaggtgcagtggttcaagaggctataaagcttatcacacaccat
tacgttcctattgataacctatttttatataatggcattaataattcatccgcaacatat
aaaatataa

DBGET integrated database retrieval system