KEGG   Saccharomyces cerevisiae (budding yeast): YPL034W
Entry
YPL034W           CDS       T00005                                 
Name
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: T5orf172
Other DBs
NCBI-GeneID: 856072
NCBI-ProteinID: NP_015291
SGD: S000005955
UniProt: Q03083
Position
XVI:486712..487209
AA seq 165 aa
MTTRKTVDSRLLEWQTTCKHPVINLTPEKVDKLYHLKLKSESKNISSNRLLPISLSSLQK
KMEKLFIKDKSHSHKPSLPDPKVPTLRTYKDGGFFISGKGSMKLPDIESAIHKFLWKKYG
KGLVYCYGCDPTGKKRHTEWFNVPVLELPSVLRLIDSYCLGGESR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaccactcgaaaaacagtagattcaagacttttagaatggcaaaccacatgcaagcat
ccagtgataaacttgactccagagaaagtcgataaattataccacttgaaattgaaaagt
gaaagcaaaaatatcagttcaaacaggctattgcccatttcattatcaagcttacaaaaa
aaaatggagaaacttttcatcaaagataaaagtcactcacacaagccttcccttccagat
cctaaggtgccaaccctacgcacttataaagatggtggatttttcattagcggaaaaggt
tcaatgaaactaccagatatcgaaagcgctattcataaatttttatggaagaaatacggg
aaaggattggtttactgttatgggtgtgatccaactggaaaaaagaggcatacagagtgg
ttcaatgtgcctgtattggagctaccatcagtactaagacttattgattcttattgcctt
ggaggagaatctcgttag

DBGET integrated database retrieval system