KEGG   Saccharomyces cerevisiae (budding yeast): YPL058C
Entry
YPL058C           CDS       T00005                                 

Gene name
PDR12
Definition
(RefSeq) ATP-binding cassette multidrug transporter PDR12
  KO
K08712  ATP-binding cassette, subfamily G (WHITE), member 2, SNQ2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YPL058C (PDR12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPL058C (PDR12)
Transporters [BR:sce02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    YPL058C (PDR12)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran PDR_CDR ABC2_membrane_7 ABC_trans_N RsgA_GTPase AAA_16 MMR_HSR1 ABC2_membrane_3 AAA_18 AAA_29 AAA_22 TsaE AAA_25 NACHT AAA_30 cobW Zeta_toxin AAA_17 AAA_23
Other DBs
NCBI-GeneID: 856049
NCBI-ProteinID: NP_015267
SGD: S000005979
UniProt: Q02785
Position
XVI:complement(445842..450377)
AA seq 1511 aa
MSSTDEHIEKDISSRSNHDDDYANSVQSYAASEGQVDNEDLAATSQLSRHLSNILSNEEG
IERLESMARVISHKTKKEMDSFEINDLDFDLRSLLHYLRSRQLEQGIEPGDSGIAFKNLT
AVGVDASAAYGPSVEEMFRNIASIPAHLISKFTKKSDVPLRNIIQNCTGVVESGEMLFVV
GRPGAGCSTFLKCLSGETSELVDVQGEFSYDGLDQSEMMSKYKGYVIYCPELDFHFPKIT
VKETIDFALKCKTPRVRIDKMTRKQYVDNIRDMWCTVFGLRHTYATKVGNDFVRGVSGGE
RKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIRTATNMVNNSAIVAIYQAGENI
YELFDKTTVLYNGRQIYFGPADKAVGYFQRMGWVKPNRMTSAEFLTSVTVDFENRTLDIK
PGYEDKVPKSSSEFEEYWLNSEDYQELLRTYDDYQSRHPVNETRDRLDVAKKQRLQQGQR
ENSQYVVNYWTQVYYCMIRGFQRVKGDSTYTKVYLSSFLIKALIIGSMFHKIDDKSQSTT
AGAYSRGGMLFYVLLFASVTSLAEIGNSFSSRPVIVKHKSYSMYHLSAESLQEIITEFPT
KFVAIVILCLITYWIPFMKYEAGAFFQYILYLLTVQQCTSFIFKFVATMSKSGVDAHAVG
GLWVLMLCVYAGFVLPIGEMHHWIRWLHFINPLTYAFESLVSTEFHHREMLCSALVPSGP
GYEGISIANQVCDAAGAVKGNLYVSGDSYILHQYHFAYKHAWRNWGVNIVWTFGYIVFNV
ILSEYLKPVEGGGDLLLYKRGHMPELGTENADARTASREEMMEALNGPNVDLEKVIAEKD
VFTWNHLDYTIPYDGATRKLLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVI
TGDMLVNAKPLPASFNRSCGYVAQADNHMAELSVRESLRFAAELRQQSSVPLEEKYEYVE
KIITLLGMQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAW
SIVQFMRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGPNSETLLKYF
ERQSGMKCGVSENPAEYILNCIGAGATASVNSDWHDLWLASPECAAARAEVEELHRTLPG
RAVNDDPELATRFAASYMTQIKCVLRRTALQFWRSPVYIRAKFFECVACALFVGLSYVGV
NHSVGGAIEAFSSIFMLLLIALAMINQLHVFAYDSRELYEVREAASNTFHWSVLLLCHAA
VENFWSTLCQFMCFICYYWPAQFSGRASHAGFFFFFYVLIFPLYFVTYGLWILYMSPDVP
SASMINSNLFAAMLLFCGILQPREKMPAFWRRLMYNVSPFTYVVQALVTPLVHNKKVVCN
PHEYNIMDPPSGKTCGEFLSTYMDNNTGYLVNPTATENCQYCPYTVQDQVVAKYNVKWDH
RWRNFGFMWAYICFNIAAMLICYYVVRVKVWSLKSVLNFKKWFNGPRKERHEKDTNIFQT
VPGDENKITKK
NT seq 4536 nt   +upstreamnt  +downstreamnt
atgtcttcgactgacgaacatattgagaaagacatttcgtcgagatcgaaccatgacgat
gattatgctaattcggtacaatcctacgctgcctccgaaggccaagttgataatgaggat
ttggcagccacttctcagctatcccgtcacctttcaaacattctttccaatgaagaaggt
attgaaaggttggagtctatggcgagagtcatttcacataagacaaagaaggaaatggac
tcttttgaaattaatgacttagattttgatttgcgctcactattacattatttgaggtct
cgtcaattggaacagggaattgaacctggtgattctggtattgcctttaaaaacctaaca
gcagtcggtgttgatgcctctgctgcatatgggcctagtgttgaagagatgtttagaaat
attgctagtataccggcacatctcataagtaaatttaccaagaaatctgatgtcccatta
aggaatattattcaaaattgtacgggtgtcgttgaatctggtgaaatgttatttgtcgtc
ggtaggccaggtgcaggttgctccactttcctaaagtgtctatctggtgaaacttcagaa
ttagttgatgtacaaggtgaattctcctatgatggtctggaccaaagcgaaatgatgtct
aagtataaaggttacgttatttactgtcccgagcttgatttccatttcccaaaaattact
gtgaaggaaacaatcgattttgccctaaaatgtaagactcctcgtgttagaattgacaaa
atgacgagaaagcaatacgttgataacatcagagatatgtggtgtaccgtttttggttta
agacacacatatgccaccaaagtcggtaacgatttcgtaagaggtgtttctggtggtgaa
cgtaagcgtgtttccttggttgaagctcaggcaatgaatgcctccatctactcttgggat
aacgccacaagaggtttggatgcctctactgctttagagtttgcccaagccattagaacg
gctacaaatatggtaaacaactctgctattgttgctatttaccaagctggtgaaaatatt
tatgaattatttgataaaactactgttctatataacggtagacagatttacttcggtcct
gctgataaagctgttggatatttccaaagaatgggttgggttaaaccaaacagaatgacc
tctgcggaatttttaacatccgtcacggtcgattttgaaaataggacattggatattaaa
cctggctatgaagataaagttccaaaatctagttcagagtttgaggaatactggttgaac
tctgaggattatcaggaacttttaagaacttatgatgattatcaaagtagacaccctgtt
aatgaaacgagagatagactggatgtggccaagaagcaaagactgcaacaaggccaaaga
gaaaattctcaatatgttgtcaattattggacacaagtttattattgtatgattcgtggt
tttcaaagggttaagggtgattcaacgtatactaaggtctacttaagttcttttttgatc
aaagctttgattatcggttctatgttccacaaaattgatgacaaaagtcaatccaccacg
gcaggtgcttattctcgtggtggtatgttattctatgttttattgttcgcttctgttact
tccttggccgaaattggtaactctttttctagtagacctgttattgtcaaacacaaatca
tattccatgtaccatttgtctgcggaatcgttacaagagattatcactgagttccctact
aaatttgtcgctattgtgatactatgtttgattacttactggattccatttatgaaatat
gaagctggtgctttcttccagtatattttatatctactgactgtgcaacaatgtacttct
ttcattttcaagtttgttgctactatgagtaaatctggtgtggatgcccatgccgtcggt
ggtttatgggtcctgatgctttgtgtttatgctggttttgtcttgccaattggtgaaatg
catcattggattagatggcttcatttcattaatcctttaacttatgcttttgaaagttta
gtttccactgaatttcaccacagggaaatgttgtgtagcgccttagtcccatctggtcct
ggttatgaaggtatttctattgctaaccaagtctgtgatgctgctggtgcggttaagggt
aacttgtatgttagcggtgactcttacatcttacaccaatatcatttcgcatataagcat
gcttggagaaattggggtgtgaacattgtgtggacttttggttatattgtgttcaatgtc
atcttatcagaatatttgaaacctgttgagggaggaggtgacttgctgttatataagaga
ggtcatatgccggagttaggtaccgaaaatgcagatgcaagaaccgcttccagagaggaa
atgatggaggctctgaatggtccaaatgtcgatttagaaaaggtcattgcagaaaaggac
gttttcacctggaaccatctggactacaccattccatacgacggagctacaagaaaatta
ttatcggatgtctttggttacgttaagcctggtaagatgaccgccttgatgggtgaatcc
ggtgctggtaaaactaccttgttaaatgttttagcacaaagaatcaatatgggtgtcatc
actggtgatatgttagtcaatgccaagcccttgcctgcttctttcaacagatcatgtggt
tatgttgcgcaagccgataatcatatggccgaattatctgttagggaatccctgagattt
gcagccgagttaagacagcaaagttccgttccgttagaggagaaatatgaatatgttgaa
aaaattatcacattgctaggtatgcaaaattacgctgaagccttagttggtaagactggt
agaggtttgaacgttgaacagagaaagaagttatctattggtgttgaactggttgctaaa
ccatcattattattgtttttggatgagcctacctctggtctggactctcagtctgcttgg
tcaattgttcaattcatgagagccttagctgattctggtcaatccattttgtgtacgatt
catcaaccctctgctaccttgtttgaacagtttgacagattgttgttgttaaagaaaggt
ggtaagatggtttactttggtgacattggtccaaattctgaaactttgttgaagtatttt
gaacgtcaatctggtatgaagtgtggtgtttctgaaaatccagctgaatatattttgaat
tgtattggtgccggtgccactgctagtgttaactctgattggcacgacttatggcttgct
tccccagaatgtgccgctgcaagggctgaagttgaagaattacatcgtactttacctggt
agagcagttaatgatgatcctgagttagctacaagatttgctgccagttacatgactcaa
atcaaatgtgttttacgtagaacagctcttcaattttggagatcgcctgtctatatcagg
gccaaattctttgaatgtgtcgcatgtgctttgttcgtcggtttatcatatgttggtgta
aatcactctgttggtggtgccattgaggccttttcgtctattttcatgctattattgatt
gctctggctatgatcaatcaactgcacgtcttcgcttatgatagtagggaattatatgag
gttagagaagccgcttctaacactttccattggagtgtcttgttattatgtcatgctgct
gttgaaaacttttggtccacactttgtcagtttatgtgtttcatttgctactactggcca
gctcaattcagtggacgtgcatctcatgcaggtttcttcttcttcttctatgttttaatt
ttcccattatattttgtcacatatggtctatggatcctgtacatgtctcctgatgttccc
tcagcttctatgattaattccaatttgtttgctgctatgttactgttctgtggtatttta
caaccaagagagaaaatgcctgccttctggagaagattgatgtataatgtatcaccattt
acctacgtggttcaagctttggttacaccattagttcacaataaaaaggtcgtttgtaat
cctcatgaatacaacatcatggacccaccaagcggaaaaacttgtggtgagtttttatct
acctatatggacaataataccggttatttggtaaatccaactgccaccgaaaactgtcaa
tattgcccatacactgttcaagatcaagttgtggctaaatacaatgtcaaatgggatcac
agatggagaaactttggtttcatgtgggcttatatttgcttcaatattgccgctatgttg
atttgttactatgttgtaagagttaaggtgtggtctttgaagtctgttttgaatttcaag
aaatggtttaatgggccaagaaaggaaagacatgaaaaagataccaacattttccaaaca
gttccaggtgacgaaaataaaatcacgaagaaataa

DBGET integrated database retrieval system