KEGG   Saccharomyces cerevisiae (budding yeast): YPL060WHelp
Entry
YPL060W           CDS       T00005                                 

Gene name
MFM1, LPE10
Definition
(RefSeq) Mfm1p
  KO
K16075  magnesium transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPL060W (MFM1)
Transporters [BR:sce02000]
 Other Transporters
  Pores ion channels [TC:1]
   YPL060W (MFM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorA DUF2207
Motif
Other DBs
NCBI-GeneID: 856045
NCBI-ProteinID: NP_015265
SGD: S000005981
UniProt: Q02783
Position
XVI:434523..435764
Genome map
AA seq 413 aa AA seqDB search
MRAFPRVLPFRHQRSYNNILLRTVRLFGSSLSSFDFSRQMPKVDPDNTAAMLLQKNLIQR
NNMLYGYGSGTIRCTLLDSTGRAKSPLVEIKREDLVSKHGLLPRDLRKIEKSRKNDLVPS
LLVRENSILISLLTVKALIKPDMVIIFDSAGSGITLNSEAHKDFINDMKLRLKNQETSEL
NSDPLPYEFRALETIFISALSNLTSEMKVLLTICKGVLQDLEFSITRDKLRFLLGQNKKL
SSFNKKAVLVKDMLDDLLEQDDMLCDMYLTDKKAGKIRVQDDHTEIEMLLETYHNYVDEI
VQKSESAISDVKTTEEIINIILDSNRNELMLLGIRYAIGMLSLGGALFLGSIYGMNLESF
IEESNYAYLTVTILGLISTVWLYAKGIRHLHKLQRMTLLSKIKTDSVHELLKK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagagcattcccccgagtactgccatttcgccatcagagatcatataataacatcctt
cttcgaacagtaaggctttttggttcatcactttcttcttttgatttctctaggcaaatg
cctaaggtggaccctgacaataccgctgcaatgctactacagaaaaacttgatccaaaga
aacaacatgctctatgggtatggatcagggacaatacgatgtactttgctagactcaact
ggacgagccaaatcaccattagtagagataaaacgtgaggatctagtatcaaaacatggc
ttgttgcccagagatctacgtaaaattgaaaaatcaaggaagaatgacttagtccctagt
ttgctcgtgcgagaaaattccatactaatcagtttacttactgtgaaagccctaattaag
cctgatatggttattatcttcgattcagccggcagtggaataactttaaactcagaagct
cacaaggattttattaacgatatgaaattgagactaaaaaatcaagaaacaagcgagcta
aatagcgatccacttccttatgaattcagagctttagaaacgatcttcatttcggcatta
tctaaccttaccagtgaaatgaaggtgttgctaaccatatgcaagggggtgcttcaagat
ctagaatttagtataacaagagataaattaaggttcttactgggtcaaaacaaaaaattg
agcagcttcaataaaaaggctgttctagttaaagatatgctggatgacttgctagagcaa
gacgatatgctttgtgatatgtacttaaccgacaaaaaggctggaaaaattagagttcaa
gatgatcatactgaaattgaaatgcttctggaaacatatcataactatgtcgatgaaata
gttcagaaaagcgaaagcgccatatctgacgtgaaaaccacagaagaaatcatcaatata
atcctagattctaacagaaacgaattaatgctgttagggataagatacgccataggaatg
ctttcgttgggaggcgctctattcctgggttctatctatggtatgaatctggaaagtttc
atagaagaaagtaattatgcgtatttaactgtcaccattttggggttaatatctactgtt
tggctctatgcgaagggaatcagacatttgcataaattacaacgtatgacattattgagt
aaaataaaaacagattccgttcacgaactgttgaagaaatag

DBGET integrated database retrieval system