KEGG   Saccharomyces cerevisiae (budding yeast): YPL081WHelp
Entry
YPL081W           CDS       T00005                                 

Gene name
RPS9A
Definition
(RefSeq) ribosomal 40S subunit protein S9A
  KO
K02997  small subunit ribosomal protein S9e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YPL081W (RPS9A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YPL081W (RPS9A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YPL081W (RPS9A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4
Motif
Other DBs
NCBI-GeneID: 856024
NCBI-ProteinID: NP_015244
SGD: S000006002
UniProt: O13516
Structure
PDB: 

Position
XVI:join(404950..404956,405458..406044)
Genome map
AA seq 197 aa AA seqDB search
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAADEADEADEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagccccaagaacatattccaagacttactctaccccaaagagaccttacgaa
tcttctcgtttggacgcagaattgaagttggccggtgaattcggtttgaagaacaagaag
gaaatttacagaatttccttccagttatctaagattcgtcgtgctgcaagagacttgttg
acaagagacgaaaaggacccaaagagattgttcgaaggtaatgctttgattaggagacta
gttagagtcggtgttttatccgaagataagaagaagttagattatgttttagccttgaag
gtcgaagatttcttggaaagaagattgcaaactcaagtctacaagctaggtttagccaag
tctgtccaccatgcaagagttttaatcactcaaaggcacattgctgttggtaagcaaatt
gtcaacatcccctctttcatggtcagattggactctgagaagcacattgactttgctcca
acatctccattcggtggtgctagaccaggcagagttgctagaagaaatgctgcaaggaag
gcggaagcttctggtgaagctgctgatgaagctgatgaggccgatgaagaataa

DBGET integrated database retrieval system