KEGG   Saccharomyces cerevisiae (budding yeast): YPL082CHelp
Entry
YPL082C           CDS       T00005                                 

Gene name
MOT1, BUR3, END10, LPF4
Definition
(RefSeq) DNA-binding ATPase
  KO
K15192  TATA-binding protein-associated factor [EC:3.6.4.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YPL082C (MOT1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     YPL082C (MOT1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     YPL082C (MOT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3535 SNF2_N Helicase_C HEAT ResIII MMS19_N U3snoRNP10 ERCC3_RAD25_C GUN4_N
Motif
Other DBs
NCBI-GeneID: 856023
NCBI-ProteinID: NP_015243
SGD: S000006003
UniProt: P32333
Position
XVI:complement(398480..404083)
Genome map
AA seq 1867 aa AA seqDB search
MTSRVSRLDRQVILIETGSTQVVRNMAADQMGDLAKQHPEDILSLLSRVYPFLLVKKWET
RVTAARAVGGIVAHAPSWDPNESDLVGGTNEGSPLDNAQVKLEHEMKIKLEEATQNNQLN
LLQEDHHLSSLSDWKLNEILKSGKVLLASSMNDYNVLGKADDNIRKQAKTDDIKQETSML
NASDKANENKSNANKKSARMLAMARRKKKMSAKNTPKHPVDITESSVSKTLLNGKNMTNS
AASLATSPTSNQLNPKLEITEQADESKLMIESTVRPLLEQHEIVAGLVWQFQGIYELLLD
NLMSENWEIRHGAALGLRELVKKHAYGVSRVKGNTREENNLRNSRSLEDLASRLLTVFAL
DRFGDYVYDTVVAPVRESVAQTLAALLIHLDSTLSIKIFNCLEQLVLQDPLQTGLPNKIW
EATHGGLLGIRYFVSIKTNFLFAHGLLENVVRIVLYGLNQSDDDVQSVAASILTPITSEF
VKLNNSTIEILVTTIWSLLARLDDDISSSVGSIMDLLAKLCDHQEVLDILKNKALEHPSE
WSFKSLVPKLYPFLRHSISSVRRAVLNLLIAFLSIKDDSTKNWLNGKVFRLVFQNILLEQ
NPELLQLSFDVYVALLEHYKVKHTEKTLDHVFSKHLQPILHLLNTPVGEKGKNYAMESQY
ILKPSQHYQLHPEKKRSISETTTDSDIPIPKNNEHINIDAPMIAGDITLLGLDVILNTRI
MGAKAFALTLSMFQDSTLQSFFTNVLVRCLELPFSTPRMLAGIIVSQFCSSWLQKHPEGE
KLPSFVSEIFSPVMNKQLLNRDEFPVFRELVPSLKALRTQCQSLLATFVDVGMLPQYKLP
NVAIVVQGETEAGPHAFGVETAEKVYGEYYDKMFKSMNNSYKLLAKKPLEDSKHRVLMAI
NSAKESAKLRTGSILANYASSILLFDGLPLKLNPIIRSLMDSVKEERNEKLQTMAGESVV
HLIQQLLENNKVNVSGKIVKNLCGFLCVDTSEVPDFSVNAEYKEKILTLIKESNSIAAQD
DINLAKMSEEAQLKRKGGLITLKILFEVLGPSILQKLPQLRSILFDSLSDHENEEASKVD
NEQGQKIVDSFGVLRALFPFMSDSLRSSEVFTRFPVLLTFLRSNLSVFRYSAARTFADLA
KISSVEVMAYTIREILPLMNSAGSLSDRQGSTELIYHLSLSMETDVLPYVIFLIVPLLGR
MSDSNEDVRNLATTTFASIIKLVPLEAGIADPKGLPEELVASRERERDFIQQMMDPSKAK
PFKLPIAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKE
DYEKTRSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLRPQLSDA
DIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPI
QNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQV
LPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADGK
QHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLSALRTLLFE
CGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLD
GSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMD
RAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLF
DPDNVTSQDNEEKNNGDSQAAKGMEDIANETGLTGKAKEALGELKELWDPSQYEEEYNLD
TFIKTLR
NT seq 5604 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgagtttcgaggctggaccggcaggtaatattaatagagaccggttccacc
caagtagtccggaacatggctgccgatcaaatgggagacttggccaaacagcaccccgaa
gacattctttcgttgctgtccagagtttacccctttttactagtgaagaaatgggaaacg
cgtgttactgcagcaagagctgtgggtggcatagttgcccatgctccttcttgggatccg
aatgaatctgacttggtaggtggtacaaatgaaggttctccattggataatgctcaggtg
aagttggaacatgaaatgaaaataaaattggaagaggctactcagaacaatcagttgaat
ctcttacaggaggaccatcacctcagttctctgtctgattggaaattgaacgaaatttta
aagtcaggtaaagtgctcctggcgtcgagtatgaatgattacaatgttcttggtaaggct
gacgataatataagaaaacaagctaaaactgatgatataaaacaggaaacatctatgcta
aatgcgtctgataaggcgaatgaaaataaaagtaatgctaacaagaagtcagcaaggatg
cttgctatggcaaggcgaaaaaagaaaatgagtgctaagaatactcccaaacatcctgta
gatataacggaaagttcagtttccaagactttattaaatggaaaaaatatgaccaattct
gctgcatcgctagccacttctcccaccagtaaccagctaaatcccaaactggagattact
gaacaagccgatgaaagtaaactaatgatagaatccacagtaaggccattgctagaacaa
cacgaaattgttgctggcctagtttggcaattccaaggcatttatgaactacttttagat
aatctaatgagcgaaaattgggaaataaggcatggagctgcgttgggtcttcgagaattg
gtaaaaaaacatgcttatggagtcagcagggttaaggggaatacccgagaggagaacaac
ctgaggaattctagaagcttagaagacttggcgtcccgtctacttacagtatttgcattg
gatagatttggtgattatgtttatgatacagttgtggcccctgtacgagagtcagttgcg
caaactctagctgcgttattaattcacctagacagtaccttatcaattaaaatatttaat
tgtttagaacaactggttctacaagatccactacaaacaggtctaccgaacaaaatatgg
gaagctacccatggagggcttttagggattcgttacttcgtcagcataaagacaaatttc
ctatttgcccatggccttttagaaaacgttgtccgtatagtgctatatggtttaaaccaa
agtgatgatgacgttcaaagcgtagcagcctcaattttaaccccaataaccagcgaattt
gtcaaattaaacaactctaccatagaaattttggtgaccacgatatggtcattactagct
cgtttagatgatgatatatcttcaagcgtaggttctataatggatctattggcaaagttg
tgcgaccaccaagaagtactagatattttaaagaacaaggctttagagcatccttcagag
tggtcattcaagtcactggtaccgaaattgtatccctttttacgccattcgatttcttct
gtgaggagggctgttttgaatctactgattgcattcttatcaataaaggatgattctact
aaaaactggttaaacggcaaggtattccgtctagtttttcagaatattttactggagcaa
aacccggaactattgcaactgtcttttgatgtttatgttgcgttattggagcattataaa
gttaagcataccgaaaaaactttagatcatgttttcagtaaacatttgcagccaatacta
catcttctaaatacgccagtaggggaaaagggaaagaattatgccatggaatcacaatat
attctaaagccttcccagcactatcaattacatccagaaaaaaaacgttctatatctgaa
accacaacagattctgacattccaataccaaaaaataatgaacatatcaatatcgatgca
cctatgattgctggagatattactttgctaggattggacgtaatattgaacactagaata
atgggagcaaaggcatttgctttgacattgtcaatgtttcaagattccacgcttcaatcc
ttcttcacaaacgttctggttcgttgtttagagctgccattctcaactccacgtatgttg
gcaggcattattgtttcacagttttgctcctcgtggttacaaaagcatccagaaggggaa
aaattaccttcttttgtatcagagattttcagtcctgtgatgaataaacagttactgaat
cgcgatgaatttcctgtatttagggagctagtacctagcttaaaagctctgaggactcaa
tgtcaaagcctactggctacctttgtggatgtaggtatgttacctcagtacaaactaccc
aacgtagcaattgtggttcaaggcgaaacagaagccggtccacatgcgtttggtgttgaa
acagcagaaaaagtgtacggcgaatactatgataaaatgttcaaatccatgaacaactct
tacaaactattggccaagaagccattagaagattctaagcatcgcgtgttgatggcaatc
aattcagccaaagaatccgcaaaacttcgtacaggcagcattctcgctaattacgcatca
tccatcttgttatttgatggtctacctcttaaattaaaccccattatcaggtcgctaatg
gacagtgttaaagaagaaaggaatgaaaagttacaaacgatggccggagaatcggtcgta
catttgattcagcaactgttagaaaataataaagttaatgtgtctggtaagatagtcaaa
aatctctgcggatttttatgcgttgatacttcagaagttcctgatttctccgtaaatgca
gaatataaagaaaaaatattgacgttaataaaagaatctaattcgattgccgcacaagat
gacattaatctcgcaaagatgtcggaagaggctcaactaaaaaggaagggtgggttgatt
acgttaaaaatactatttgaagttcttgggccttctatattacagaaactacctcagctt
agatcgattttatttgattcattatctgatcatgaaaatgaggaagcaagtaaagttgac
aacgagcaaggtcaaaaaatagtcgactcatttggtgtactaagagctctattcccattt
atgtctgattcgctacgttctagtgaggtttttacccgtttccctgttttattaacgttc
ttaagatcaaacttatctgtttttcgttattcagctgcaagaacttttgctgatctggct
aaaatttcctccgtggaggtaatggcttacaccatacgtgagattttgcctttaatgaat
agcgctggttctctatccgatcgtcaagggtccacggagcttatttatcatttatcactt
tctatggaaaccgatgttctaccttacgtcattttcttaatagttccacttttgggtcgc
atgagtgattcgaacgaagatgtgaggaatttagctacaacaacatttgcttctatcatc
aaattagttcctttagaagctggtatcgccgatccaaaaggactcccagaagaactagtg
gcaagcagagagagggagcgtgattttatccaacaaatgatggatccttctaaagctaag
ccatttaaattacccattgccatcaaggcgactttaagaaaatatcagcaagatggtgtt
aactggttggcattcctgaacaaatatcatctacatggaatattgtgtgacgatatgggt
ttgggtaaaacattacaaaccatctgcattatcgcaagcgatcaatatttgaggaaggaa
gattatgaaaaaacgcgttctgttgaaagtagagccttaccatctctcataatatgcccc
ccatctttaactggccattgggaaaacgagtttgaccagtatgctccctttttaaaggtt
gttgtgtatgccggtggcccaactgtcagattaactctgagaccacagttaagtgatgct
gatattattgtaacatcatatgacgtagctagaaatgatctcgcagtcctaaacaaaact
gaatataattattgtgttttggatgaaggacatataattaaaaactctcaatcaaaactt
gctaaggctgttaaagaaattactgcaaaccatagattaattttaaccggaactcccatc
caaaacaacgttttagaattgtggtctctgtttgacttcttaatgccgggatttttggga
acggaaaagatgttccaggaaaggttcgcaaagccaatcgctgcgtcaagaaatagtaaa
acatcatctaaggagcaggaagcaggtgtactggctttggaggcactacataagcaagtt
ctacctttcatgctgagaagattgaaggaagacgttctatctgatttaccacctaaaatt
attcaggattactactgtgaattaggtgatttacaaaaacaactatacatggattttact
aaaaaacaaaaaaatgtagttgagaaagatattgaaaattctgagattgctgatggcaag
caacatattttccaagctttacaatacatgagaaaattgtgtaatcatccagctttggtc
ctttcaccaaatcacccgcaattagcgcaagtacaagactatttaaagcaaactggtcta
gatttacacgatattatcaacgctccaaaactgagcgcattgagaacattactctttgaa
tgtggtataggtgaagaagatatcgacaaaaaagcaagccaagatcagaattttcctatt
caaaatgtcatatcacaacacagagccctgattttctgccaactaaaagatatgctagac
atggttgaaaatgacttgtttaaaaagtatatgccctccgtaacctatatgaggctagat
ggaagcattgacccaagagacagacaaaaagttgttcggaaatttaacgaagatccctct
attgattgcctactgttgaccaccaaggtcggagggctgggtctgaatttaactggtgca
gacaccgtcatttttgtagagcatgactggaatccaatgaatgatctacaggcaatggac
agagcacatagaattggtcagaaaaaggttgttaatgtttacagaattattacgaaaggt
acgcttgaagaaaaaatcatgggtttgcagaaattcaaaatgaatatagcttctacagtt
gttaatcagcaaaacagtggattagcatccatggatacacatcagctgcttgatctcttc
gaccccgataacgttacctcacaggacaatgaggaaaagaataatggcgattcccaagca
gccaagggcatggaagatattgccaacgagactggtttaactggcaaagccaaagaggcc
ctcggtgaattgaaagagctatgggacccatctcaatacgaggaggagtataatttagac
accttcatcaaaactttacgataa

DBGET integrated database retrieval system