KEGG   Saccharomyces cerevisiae (budding yeast): YPL083CHelp
Entry
YPL083C           CDS       T00005                                 

Gene name
SEN54
Definition
(RefSeq) tRNA splicing endonuclease subunit SEN54
  KO
K15326  tRNA-splicing endonuclease subunit Sen54
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YPL083C (SEN54)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    YPL083C (SEN54)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_int_end_N2 SH3BGR
Motif
Other DBs
NCBI-GeneID: 856022
NCBI-ProteinID: NP_015242
SGD: S000006004
UniProt: Q02825
Position
XVI:complement(396702..398105)
Genome map
AA seq 467 aa AA seqDB search
MQFAGKKTDQVTTSNPGFEEEEEEEEELQQDWSQLASLVSKNAALSLPKRGEKDYEPDGT
NLQDLLLYNASKAMFDTISDSIRGTTVKSEVRGYYVPHKHQAVLLKPKGSFMQTMGRADS
TGELWLDFHEFVYLAERGTILPYYRLEAGSNKSSKHETEILLSMEDLYSLFSSQQEMDQY
FVFAHLKRLGFILKPSNQEAAVKTSFFPLKKQRSNLQAITWRLLSLFKIQELSLFSGFFY
SKWNFFFRKYTTSPQLYQGLNRLVRSVAVPKNKKELLDAQSDREFQKVKDIPLTFKVWKP
HSNFKKRDPGLPDFQVFVYNKNDDLQHFPTYKELRSMFSSLDYKFEFLSEIEDDDDWETN
SYVEDIPRKEYIHKRSAKSQTEKSESSMKASFQKKTAQSSTKKKRKAYPPHIQQNRRLKT
GYRSFIIAIMDNGLISFVKMSEADFGSESVWYTPNTQKKVDQRWKKH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgctgggaagaaaactgatcaagtgaccacatctaatccgggctttgaagaa
gaagaagaagaagaagaagaactacaacaagattggtcgcaactcgcatcgctcgttagc
aaaaatgctgctctttcacttccaaagaggggtgaaaaagactatgaaccagatgggact
aatttgcaagatctgcttctctataatgcaagtaaagccatgtttgataccatatcagac
tcaataagaggcacaacagtaaaatctgaagtaagaggatactatgttccccataaacat
caagccgttctacttaaacccaaaggcagctttatgcaaacgatgggaagggctgatagc
acaggcgaactctggcttgacttccatgagtttgtttatttggcagagagaggcactatt
cttccttattatagattagaagcaggctctaacaaaagctcaaagcacgaaacagagatt
ttactcagtatggaggatttgtattcgctgttttcatcgcaacaggaaatggaccaatat
tttgtgtttgctcatttaaaaaggttgggttttattctaaaacccagcaatcaagaagca
gcagtcaagacttcctttttcccattgaaaaagcaacgaagtaatttacaagcaatcact
tggagattactttcattgtttaaaatacaagagttatcgctgtttagtggtttcttctat
tctaagtggaattttttttttcgtaaatatacgacttcaccacagttataccagggttta
aataggcttgttcgttccgtggctgtaccaaagaataaaaaagagctattggatgcacaa
tctgatagggaatttcaaaaggtaaaggatattcccttgacatttaaagtatggaaaccc
cattctaatttcaagaaaagagaccccggtcttcctgatttccaagttttcgtttacaat
aaaaatgacgatcttcagcattttcctacctataaagagctgcgatctatgttttcctca
cttgattataaattcgaatttttaagcgaaatcgaggatgatgacgattgggagacaaac
tcctacgttgaagatatcccacgaaaggaatatattcataagaggagcgcgaaatctcaa
actgaaaaaagtgagtcgtctatgaaagcaagttttcaaaaaaaaactgcacagtctagc
acgaaaaagaagagaaaggcgtacccacctcacatacagcaaaatcgtagattgaagacg
ggatatcggagctttattatcgctattatggataatggccttatttcgtttgtaaaaatg
tccgaggctgattttggatctgaaagtgtatggtatacacctaatactcaaaagaaagta
gatcaaagatggaagaagcattaa

DBGET integrated database retrieval system