KEGG   Saccharomyces cerevisiae (budding yeast): YPL084WHelp
Entry
YPL084W           CDS       T00005                                 

Gene name
BRO1, ASI6, LPF2, NPI3, VPS31
Definition
(RefSeq) Bro1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BRO1 ALIX_LYPXL_bnd
Motif
Other DBs
NCBI-GeneID: 856021
NCBI-ProteinID: NP_015241
SGD: S000006005
UniProt: P48582
Structure
PDB: 

Position
XVI:394038..396572
Genome map
AA seq 844 aa AA seqDB search
MKPYLFDLKLKDTEKLDWKKGLSSYLKKSYGSSQWRTFYDEKATSELDHLRNNANGELAP
SSLSEQNLKYYSFLEHLYFRLGSKGSRLKMDFTWYDAEYSSAQKGLKYTQHTLAFEKSCT
LFNIAVIFTQIARENINEDYKNSIANLTKAFSCFEYLSENFLNSPSVDLQSENTRFLANI
CHAEAQELFVLKLLNDQISSKQYTLISKLSRATCNLFQKCHDFMKEIDDDVAIYGEPKWK
TTVTCKLHFYKSLSAYYHGLHLEEENRVGEAIAFLDFSMQQLISSLPFKTWLVEFIDFDG
FKETLEKKQKELIKDNDFIYHESVPAVVQVDSIKALDAIKSPTWEKILEPYMQDVANKCD
SLYRGIIPLDVYEKESIYSEEKATLLRKQVEETETANLEYSSFIEFTNLPRLLSDLEKQF
SDGNIFSNTDTQGQLMRDQIQTWCKFIQTNEFRDIEEQMNKIVFKRKQILEILSALPNDQ
KENVTKLKSSLVAASNSDEKLFACVKPHIVEINLLNDNGKIWKKFDEFNRNTPPQPSLLD
IDDTKNDKILELLKQVKGHAEDLRTLKEERSRNLSELRDEINNDDITKLLIINKGKSDVE
LKDLFEVELEKFEPLSTRIEATIYKQSSMIDDIKAKLDEIFHLSNFKDKSSGEEKFLEDR
KNFFDKLQEAVKSFSIFASDLPKGIEFYDSLFNMSRDLAERVRVAKQTEDSTANSPAPPL
PPLDSKASVVGGPPLLPQKSAAFQSLSRQGLNLGDQFQNLKISAGSDLPQGPGIPPRTYE
ASPYAATPTMAAPPVPPKQSQEDMYDLRRRKAVENEERELQENPTSFYNRPSVFDENMYS
KYSS
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccttacttatttgacctaaagctaaaagacacagagaagctggattggaaaaaa
ggcctctcctcatatctcaagaaatcatacggctcctcacaatggagaacattttatgat
gagaaagctacttcagaactggatcacttaaggaataatgcaaatggagaactagcacct
tcttcattgtcggaacaaaatctaaaatattactcatttttggagcatctttattttcgc
ctgggtagcaaaggatcaagattaaaaatggatttcacttggtatgacgcagaatactca
tcggcccagaaaggattgaaatacacgcaacatacgttagcatttgaaaagtcttgtact
ttgttcaacattgctgtaatctttacccaaattgcgagggagaatatcaatgaggactac
aaaaactcaatcgcaaatttgacaaaagctttttcctgttttgaatatctatcagaaaat
tttttgaactcaccttcagtcgatcttcagtcagaaaacactaggtttctggctaatatt
tgccatgcagaagctcaagaattgtttgtcttgaaattattaaatgatcaaatatcatcc
aagcaatatacattaatcagtaaactttctagagccacgtgtaacctctttcagaaatgt
cacgattttatgaaagaaatagatgacgatgtggccatttatggtgaacccaaatggaaa
acgacagttacttgcaaactgcatttctacaaatcgttaagcgcttattatcacggttta
caccttgaagaagaaaatagagttggcgaagcaattgcttttctcgatttttctatgcaa
caattgatttcatcccttccattcaaaacgtggttagtggaatttatagactttgatggg
tttaaagaaactttagaaaagaaacaaaaggagttgattaaagataacgattttatatat
catgaaagcgttccagccgttgtgcaggttgattccattaaggcgctcgatgcaataaaa
tctccaacatgggagaagatattagaaccatatatgcaagatgttgcaaataaatgtgac
tctttgtacagaggaattattcccctagatgtctatgaaaaggaaagtatttactcagaa
gaaaaagcgacgctgttgagaaagcaagttgaagaaactgagacagcaaatttggaatat
tcttccttcatcgaatttacaaatctacccaggctcttgagtgatttggaaaaacaattt
agtgacggaaatattttctcgaatacggatacacagggacaattgatgagggaccaaatt
cagacatggtgtaaatttatccaaacaaatgaatttagggatatagaagaacagatgaac
aaaattgttttcaaaaggaaacaaattttagaaatcctttctgccttacccaatgatcaa
aaagaaaatgttacaaaactaaaatcttctttagtagctgcttcaaactcagacgaaaaa
ttgttcgcatgcgtaaaaccacatattgtcgagatcaatctattgaatgacaatggaaaa
atatggaagaagtttgacgaatttaatcgcaatacgcctccacaacctagcctattggat
atcgatgataccaaaaacgacaagatattagagttgttaaaacaagtaaagggccatgcg
gaagacttaagaacattgaaagaggaacgttcgagaaatttgtctgaactaagagacgaa
atcaacaacgatgatatcacaaaattattaattattaataaggggaaatccgatgttgag
ctcaaagatttattcgaggtggaactggagaaattcgagcctttgagcacaagaatagag
gcgacaatttacaaacaatcttcaatgatagatgacatcaaagccaagctagatgaaatt
tttcacctttcaaatttcaaggataaatcttctggggaagaaaaatttttagaagatcgt
aagaatttttttgataagctgcaagaagcagtgaaatcattcagtatttttgcatccgac
ttgccaaaaggaatagagttctatgattcattattcaatatgagtagagacttagcagaa
agagtgagagttgcaaagcagaccgaggattcaacagctaattctcccgctcctcccctc
cctccacttgattctaaagcgtctgtcgttgggggtcctccattactgccccaaaaaagt
gcagcctttcagtcattatctagacaagggctcaatttaggggaccaatttcaaaatctc
aaaataagtgccggcagtgatttacctcaaggacccggtattccaccaagaacttatgaa
gcttcgccatatgctgcaacgcctactatggcagccccaccagtaccaccgaaacaatcg
caagaggatatgtacgacttgagaagacgtaaagcagttgaaaacgaagaacgtgaactg
caagagaatcctacgtccttttacaatagaccctctgtttttgatgaaaatatgtactcc
aaatacagcagttag

DBGET integrated database retrieval system