KEGG   Saccharomyces cerevisiae (budding yeast): YPL085WHelp
Entry
YPL085W           CDS       T00005                                 

Gene name
SEC16, LPF1
Definition
(RefSeq) Sec16p
  KO
K20353  COPII coat assembly protein SEC16
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPL085W (SEC16)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    YPL085W (SEC16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec16_C Sec16_N Sec16 Nup96
Motif
Other DBs
NCBI-GeneID: 856020
NCBI-ProteinID: NP_015240
SGD: S000006006
UniProt: P48415
Structure
PDB: 

Position
XVI:387067..393654
Genome map
AA seq 2195 aa AA seqDB search
MTPEAKKRKNQKKKLKQKQKKAAEKAASHSEEPLELPESTINSSFNDDSVNRTESDIASK
SDVPPVSSSTNISPANETQLEIPDTQELHHKLLNDSDQHDITADSNDLPDNSIVEHDSVI
TQTKPAMSQEYEETAAHLSSRNPSLDVVAGELHNNNEHTQKIAVSAVEEDSFNEEEGENH
DSIIISSLNDATPSQYNHFLPSDGNLLSPELSSGDTPTHNVPLGTKDNEINDDEYCNDKE
ISLNANNVLPDELSKEEDERLKLETHVSTEEKKQDIADQETAENLFTSSTEPSENKIRNS
GDDTSMLFQDDESDQKVPWEEDVKKDFHNENTNNTQESAPNTDDRDKGYEGNEALKKSES
CTAADERSYSEETSEDIFHGHDKQVVEGQNDFTGKNIENESQKLMGEGNHKLPLSAEADI
IEPGKDIQDQAEDLFTQSSGDLGEVLPWESTDKNADVTSKSQEKHEDLFAASGNDEKLPW
EVSDGEVSSGKTENSMQTSTEKIAEQKFSFLENDDDLLDDDDSFLASSEEEDTVPNTDNT
TNLTSKPVEEKKASRYKPIIEEEAGMRQEQVHFTNTTGIVTPQQFHGLTKTGLGTPNQQV
SVPNIVSPKPPVVKDNRSNFKINEEKKKSDAYDFPLEIISESSKKGHAKPVAVPTQRFGS
GNSFSSLDKPIPQSRKGSNNSNRPPVIPLGTQEPRSSRTNSAISQSPVNYAFPNPYKIQQ
LQQAPIQSGMPLPNTNIPPPALKVETTVSAPPIRARGVSNASVGSSASFGARHATQYGLN
NGVPPVSPYGQATINLPTANKYAPVSPTVQQKQYPSVVQNLGASAVNTPNFVKTHRGHTS
SISSYTPNQNEHASRYAPNYQQSYQVPYTSQPVGPVAGNSSYQSQTRSSYAVPMMPQAQT
SASIQPHANIQPPTGILPLAPLRPLDPLQAATNLQPRASNITAANSLPLANLPLAENILP
EIITHRATSSVAPPRQENNPIKIDNEALLRRQFPIFHWSAANKVVYAVPPIPDQSQYMIS
SSIVQEIKVTPIDQIIKPNDMLKSFPGPLGSAKLKKKDLTKWMETTIKSISENESSTDMT
IWQLLEMKLNDKVNWKNISKLLYNSDELLMYLSQPFPNGDMIPNAYRLDINCQMRVLAFL
QTGNHDEALRLALSKRDYAIALLVGSLMGKDRWSEVIQKYLYEGFTAGPNDQKELAHFLL
LIFQVFVGNSKMAIKSFYTNNETSQWASENWKSIVAAVLINIPENNEDPLLIPPVVLEFL
IEFGIFLTKKGLTAAASTLFIIGNVPLSNEPVMADSDVIFESIGNMNTFESILWDEIYEY
IFSYDPKFKGFSSILPQKIYHASLLQEQGLNSLGTKYTDYLSSSVRKLPKKDILTINLTR
ELSEVASRLSESNTGWLAKPKLSSVWGQLDKSFNKYIGGDDIDALNKKNDKKKVFDGFTP
GSSANSSTVDLTQTFTPFQAQVTSQSYVDTTALLHNAHNVPSHSVLHSKPSNVSKGLVEA
NLPYTHRIGDSLQGSPQRIHNTQFAAAEPQMASLRRVRTDQHTNEKALKSQQILEKKSTA
YTPQFGQNHSVPMEKSNSNVPSLFADFPAPPKLGTVPSNYVSSPDLVRRESIISTGSEFL
PPPKIGVPTKANSSQGSLMYSPSVEALPIDPVVPQVHETGYNDFGNKHSQKSMPEDESHT
SHDNSNADQNTLKDSADVTDETMDIEGPGFNDVKNLLPMEPNHQPTSTVNPIQTISDDIQ
PILQTNVEVRGTDASKMENSLPSIENERSSEEQPENISKSASSAYLPSTGGLSLENRPLT
QDENSISETVQSTYLPAGSISMEAKPISQVQDVPRNVNNKASKLVEQHMAPPKPKSTDAT
KMNYSPYVPQSTAASADGDESTILKTSPAIYARTHQAHASNPSQYFPLVNQANETASFEL
SESTSQAQSNGNVASENRFSPIKKAEVVEKDTFQPTIRKASTNQYRAFKPLESDADKYND
VIEDESDDDNMSTDEAKNRKEEKKNVNMKKETKPSNKDIDDKSNGWFGWLKKDTGDKKVY
KAKLGHKNTLYYDEKLKRWVNKDATEEEKQKIIESSAPPPPPIVKRKDGGPKTKPRSGPI
NNSLPPVHATSVIPNNPITGEPLPIKTSPSPTGPNPNNSPSPSSPISRISGVNLTSKKAN
GLDDLLSLAGGPKPASTRRKKKTARGYVNVMDNIQ
NT seq 6588 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgaagccaagaaaaggaaaaaccaaaagaagaagttgaagcaaaagcaaaaa
aaagctgctgagaaagctgctagccacagtgaagaaccacttgaattaccagaaagtacg
attaacagcagcttcaacgacgactcggtgaaccgtacagaatctgacatagcttcaaaa
tctgatgttcctccggtctcatcatctaccaatatctctccggctaatgaaacacaacta
gaaatacctgatactcaagaattgcatcataaactgctcaacgactctgatcaacatgat
attaccgcggactcaaatgatttgccagacaactcaatcgttgaacatgactctgttatt
acccaaacaaaaccagccatgtctcaagaatacgaagagactgccgctcacttatcttcg
agaaatccatcgctcgatgtagtcgcgggagaacttcacaataataatgaacatacccag
aaaattgccgtatccgctgtggaagaggattctttcaatgaagaagagggtgaaaatcac
gacagcataataatttcatcattaaacgatgctaccccttctcaatataatcattttctc
ccatccgatggcaatcttctttctccagaattatcttctggtgatacgccaactcacaat
gttcctctaggcacaaaagacaatgaaataaatgacgatgagtattgtaatgataaggaa
attagtttgaacgcaaataatgtgcttcctgatgaactttcaaaggaagaagatgaaaga
ttaaaactagaaacgcatgtatcaaccgaagaaaagaaacaggatatcgctgatcaggaa
actgcagaaaacttatttacgtctagtacagaaccatctgagaataaaataagaaattct
ggtgatgatacctccatgttgtttcaagatgacgaaagtgatcagaaggttccatgggag
gaagatgtgaagaaagattttcataatgagaacacaaataatactcaagaatcggcaccg
aacacagatgatcgtgataagggttatgaaggaaacgaagctttgaaaaagtccgaaagt
tgtacagccgcggacgagaggtcgtactctgaagaaacttcagaagatatctttcacgga
cacgacaaacaggtagttgaaggccaaaatgatttcactgggaaaaatattgagaatgaa
agccagaaattaatgggggaagggaatcataagttaccgttgtctgccgaagctgacatt
atagaacctggtaaggatattcaagatcaagccgaggatttgtttacgcagagcagcgga
gacttgggagaagttttgccatgggaatctactgataaaaacgctgatgtaacgagcaaa
tcccaagagaaacatgaagatttatttgctgcttctggaaacgatgagaaacttccttgg
gaagtttctgacggtgaagtatcatcgggaaagacggaaaacagcatgcagactagtact
gagaaaatagctgagcaaaagttttcgtttttggaaaacgacgacgaccttttggacgac
gacgacagctttttggcttcttctgaggaagaagacacagtacctaataccgataataca
acgaatttaacctcaaaaccagttgaagaaaaaaaggcttcaagatataaacctattatc
gaggaggaagcaggaatgcgtcaagagcaagttcattttaccaatactactggcattgta
acaccgcagcagttccacggtttgactaaaactggactaggcacccccaaccaacaagtc
agtgtaccaaatatagttagtcctaagcctcctgtggtaaaagacaatcgttcaaatttt
aagataaatgaggagaaaaagaagtctgatgcttacgattttccactggaaattatttca
gaaagttccaagaagggtcacgcaaagccggttgccgttcctactcaaaggtttggctca
gggaattcttttagttctttggacaaaccaattccacagagcaggaaaggctctaataac
tcaaataggccacccgtgatcccattggggacgcaggagcctcgatcttcgagaactaac
tcagcgatctcgcaatctcccgttaattatgctttccctaacccatacaaaattcaacaa
ctacaacaggctcctatccaatcaggtatgcctttaccaaataccaacatacctccccca
gcattaaaagtggaaaccaccgtttctgctcctccaattcgggcaagaggggtcagcaat
gcctccgtgggaagttcagcgtcttttggtgctagacatgcaacacagtacggcctcaat
aacggggtacctccggtttcgccatatggtcaagctaccataaatttgccaactgcgaat
aagtatgcccccgtctctcctacagttcagcagaagcaatatccatcagttgtgcaaaac
cttggcgcttcggccgtaaatacccccaattttgtaaagacccatagaggccatacaagc
tctattagttcgtatacaccaaaccagaatgaacacgcctctagatacgcacccaactat
caacaatcttatcaggtgccatatacctcacaacctgttggtcctgtagctgggaattca
agctatcaaagccaaacccgaagttcttatgcagttcctatgatgccccaggctcaaact
tcagcaagtattcagcctcacgcgaacattcaaccgcctactggcattttacctttagcc
cccttacgacctctagaccccttacaagccgctacgaacttgcaaccccgtgcaagcaac
ataacggctgcaaattcactacctcttgcaaatttgccacttgctgaaaacatactgcca
gaaattatcacgcatcgagctacaagtagtgttgcaccaccacgacaggaaaataatcca
attaaaatagacaacgaggctttattacgccgtcaatttccgatttttcattggagtgct
gcaaacaaggtcgtgtacgcagtcccccctatccctgaccaatcgcagtacatgatttca
tcaagcattgtacaggaaataaaagtgacaccaattgaccagataattaaaccgaacgat
atgctcaaaagcttcccaggtcctttgggtagtgccaaattaaaaaaaaaggatttaacc
aaatggatggaaaccactattaaatccatatctgaaaatgaatcatccactgatatgact
atatggcaactattggaaatgaaactaaacgataaagttaactggaaaaatatttcaaaa
ctactatacaattctgacgaacttttaatgtacctatctcagccctttccaaacggtgac
atgattccaaatgcatatagactggatataaattgtcagatgagagtcctggcgttctta
caaacgggaaatcacgatgaggcacttcgcttagctttaagcaagagggattatgccatt
gcactattggttggcagtttaatgggtaaagacagatggtctgaagtcattcagaaatat
ttatatgaagggtttactgcggggccaaacgaccaaaaagaattggcacactttctgctc
cttatctttcaagtatttgttggtaactccaaaatggccataaaaagtttctacactaat
aatgagaccagtcaatgggcatccgaaaactggaagagtatcgttgcagctgttctgatt
aatatcccagaaaataatgaagatccactacttataccacctgttgtccttgaatttttg
atagagttcggtatattcctcaccaaaaagggcttgacagccgcagctagtacattattt
attattggtaacgtaccactttctaatgagccagtaatggcagattcagacgttatattt
gaaagtattggaaacatgaatacttttgaaagcattctatgggatgaaatctacgagtat
atattctcgtatgaccctaaattcaaaggattttcatctattttgccccagaagatatac
catgcatctcttttacaagaacaaggtttgaacagcctggggacaaagtatactgattac
ctcagttcctcagttcgaaaactgcctaagaaagatattttaacaataaacctcactcgt
gaattgagtgaggtggctagtaggctttccgagtctaatacaggatggcttgcaaaacca
aaactaagcagcgtatggggtcaattagataaatccttcaataaatatattggtggcgat
gatattgatgcattgaataaaaaaaatgataaaaagaaagtttttgatgggttcacaccg
ggatcttctgccaattcgtcaactgtggatctcacccaaacattcacacctttccaagct
caagttacttcgcaaagctatgtggatactacagctcttttgcataatgcccataatgta
ccaagccatagtgtgctgcattcaaagccttccaatgtgtcaaaggggttagttgaagca
aacttaccgtatacgcataggatcggtgatagtttgcagggatctcctcagcgcattcat
aatacacagttcgctgctgctgagcctcaaatggcttctttgagaagagttagaacagac
cagcatacaaacgaaaaggctttgaagagtcagcagattttagagaaaaagtctacggcc
tacactccacaatttggacagaaccatagcgttccaatggaaaagtctaattcgaatgtg
ccatctttatttgccgacttccctgctccacccaaacttggaacagtgccgtctaattat
gtgtctagtcctgacttagtaagaagggagtctatcatatctaccggatcagaatttctt
cctcctcccaaaattggggtacctactaaagctaattcctcgcagggatcgcttatgtac
tcaccaagtgtggaagctttgcctatcgaccctgtcgtcccgcaagttcatgagacggga
tacaatgattttggtaacaaacattctcaaaaaagtatgcctgaagatgaatctcacaca
tcacatgataatagcaatgctgatcaaaatacattaaaagactctgcagatgttacagat
gaaacaatggatattgaaggacctggcttcaacgatgtgaagaatcttcttcctatggag
cccaaccaccagcctacgtctacagtaaatcctatacaaactattagtgacgatatccaa
ccgattcttcaaactaacgtggaggtccggggtactgatgcatcgaaaatggaaaattca
cttccctccattgaaaatgaaagaagtagcgaggagcagccagaaaacatttcaaaatca
gcatcatcagcatatttaccatcaactggtggattgtcactcgaaaacagaccgctaact
caggatgaaaacagtatctcagagacagttcaatccacatacttgccagcaggaagtatt
tcaatggaagctaaaccaatttctcaagtgcaagatgttccaagaaatgttaataataaa
gcatccaaacttgtggagcaacatatggcaccaccaaagccaaaaagtactgacgcaacc
aaaatgaactactcaccatacgtgcctcaatcaactgccgctagtgcagatggcgatgaa
tcaacgattctgaaaacatcgcctgctatatatgcaagaactcaccaagcacatgcatcc
aatccatcacaatactttcctttggtcaaccaagcaaatgaaactgcttcattcgaatta
tctgaatcaacatcccaggcacaaagtaatggaaatgttgcttcagaaaatagattcagc
ccaataaagaaagccgaagtcgtcgagaaagacacttttcaacctactattaggaaggct
tcaactaaccaatacagggcttttaaaccgttggaatcagatgcggataaatacaatgac
gttattgaagatgaatccgatgacgacaatatgtctactgatgaggcaaagaacagaaag
gaagaaaaaaagaatgtgaatatgaaaaaggaaacaaaaccaagtaacaaggacatagat
gacaagtctaatggttggtttggttggttgaagaaagatactggcgacaaaaaagtgtat
aaggccaagctaggtcataaaaacacactatactatgatgaaaaattgaaacgttgggtg
aataaggacgcaaccgaagaggaaaaacaaaaaattattgaaagttcggcaccaccacct
cctccaatcgtgaaacgtaaagatggcggcccaaagacaaagccacgttcaggccccatc
aataattccctacctccagtacatgccacatcagttattccgaacaatccaatcactggt
gagcctttgccgatcaaaacatccccttctcctacaggacccaatccaaacaattctcca
tcaccatcctctcccatatcaaggatttctggcgtaaacttgactagcaaaaaggcaaac
ggtttggatgatttattgagtttggcaggaggacccaaaccagcaagtacgagaaggaag
aagaaaacagcgagaggctatgttaatgtaatggataacatacaataa

DBGET integrated database retrieval system