KEGG   Saccharomyces cerevisiae (budding yeast): YPL106CHelp
Entry
YPL106C           CDS       T00005                                 

Gene name
SSE1, LPG3, MSI3
Definition
(RefSeq) adenyl-nucleotide exchange factor SSE1
  KO
K09485  heat shock protein 110kDa
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YPL106C (SSE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YPL106C (SSE1)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP110
   YPL106C (SSE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl Trans_reg_C NLE FtsA
Motif
Other DBs
NCBI-GeneID: 855998
NCBI-ProteinID: NP_015219
SGD: S000006027
UniProt: P32589
Structure
PDB: 

Position
XVI:complement(350194..352275)
Genome map
AA seq 693 aa AA seqDB search
MSTPFGLDLGNNNSVLAVARNRGIDIVVNEVSNRSTPSVVGFGPKNRYLGETGKNKQTSN
IKNTVANLKRIIGLDYHHPDFEQESKHFTSKLVELDDKKTGAEVRFAGEKHVFSATQLAA
MFIDKVKDTVKQDTKANITDVCIAVPPWYTEEQRYNIADAARIAGLNPVRIVNDVTAAGV
SYGIFKTDLPEGEEKPRIVAFVDIGHSSYTCSIMAFKKGQLKVLGTACDKHFGGRDFDLA
ITEHFADEFKTKYKIDIRENPKAYNRILTAAEKLKKVLSANTNAPFSVESVMNDVDVSSQ
LSREELEELVKPLLERVTEPVTKALAQAKLSAEEVDFVEIIGGTTRIPTLKQSISEAFGK
PLSTTLNQDEAIAKGAAFICAIHSPTLRVRPFKFEDIHPYSVSYSWDKQVEDEDHMEVFP
AGSSFPSTKLITLNRTGDFSMAASYTDITQLPPNTPEQIANWEITGVQLPEGQDSVPVKL
KLRCDPSGLHTIEEAYTIEDIEVEEPIPLPEDAPEDAEQEFKKVTKTVKKDDLTIVAHTF
GLDAKKLNELIEKENEMLAQDKLVAETEDRKNTLEEYIYTLRGKLEEEYAPFASDAEKTK
LQGMLNKAEEWLYDEGFDSIKAKYIAKYEELASLGNIIRGRYLAKEEEKKQAIRSKQEAS
QMAAMAEKLAAQRKAEAEKKEEKKDTEGDVDMD
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgagtactccatttggtttagatttaggtaacaataactctgtccttgccgttgctaga
aacagaggtatcgacattgtcgttaatgaagtctctaaccgttccaccccatctgttgtt
ggttttggtccaaagaacagatacttgggtgaaactggtaagaacaagcagacttccaac
atcaagaacactgtcgccaacttgaaaagaattattggtttggattaccaccatccagat
ttcgagcaagaatctaagcacttcacctctaagttggttgaattggatgacaagaagact
ggtgccgaagttagattcgctggtgagaaacatgttttttcagctactcaactagctgcc
atgttcatcgacaaagtcaaggacaccgtcaagcaggacacaaaggcaaatattaccgat
gtttgtattgctgtcccaccttggtacaccgaagaacaacgttacaacattgctgatgct
gctagaattgctggtttgaaccctgttagaattgtcaacgacgttactgctgccggtgtt
tcttacggtatcttcaagactgatttgcctgaaggcgaagaaaagccaagaattgttgcc
tttgttgatattggtcactcttcctacacctgttctatcatggccttcaagaagggtcaa
ttgaaagtcttaggaactgcctgcgacaagcattttggtggtagggacttcgatttggct
ataacagaacatttcgccgatgagttcaaaactaaatacaagattgacatcagagaaaat
ccaaaggcttacaacagaattctaactgctgctgaaaagttgaagaaagttttgtctgct
aatactaatgccccattctctgttgaatccgtcatgaacgacgttgatgtttcctctcaa
ttatctcgtgaagaattagaagaattggtcaagccattgttggaacgtgttactgaacca
gttaccaaagctttagctcaagccaaattatctgctgaagaagttgattttgttgaaatt
attggtggtactactcgtatcccaacattgaaacaatccatttctgaagccttcggcaag
ccattgtccaccactttgaaccaagatgaagccatcgccaagggtgccgcctttatttgc
gccattcactctccaactctaagagttagaccattcaagtttgaggatatccatccttac
tctgtctcttactcttgggacaagcaagttgaggacgaagaccacatggaagttttccca
gctggttcatccttcccatctactaaattgatcactttgaaccgtacgggtgacttttca
atggctgctagctacactgacatcacacagttaccaccaaacactccagaacaaatcgct
aactgggagatcactggtgttcaattaccagaaggtcaagactctgttcctgttaagtta
aagttgagatgcgacccctctggtttacacacaattgaagaggcttacactattgaagat
attgaagttgaagaacctattccattaccagaagatgctccagaagatgctgagcaagaa
tttaagaaggttactaaaactgtaaagaaggatgacttaaccatcgttgcacacaccttt
ggcctagacgctaaaaagttgaatgaattaattgaaaaagaaaatgaaatgcttgctcaa
gataagctagttgctgagacagaagaccgtaagaacactcttgaagagtacatctacaca
ttgcgtggtaagttggaagaagagtatgctccatttgcttccgatgctgaaaagacgaag
ttacaaggtatgttaaacaaggccgaagagtggttatacgatgaaggtttcgattccatc
aaagctaagtacattgccaaatacgaagaattggcttctctaggtaacattattagaggt
agatacttggctaaagaagaagaaaagaagcaagctataagatctaagcaagaagcatcc
caaatggctgctatggctgaaaagttggctgctcaaagaaaggcagaagctgaaaagaag
gaagaaaagaaggacactgaaggtgatgttgacatggactaa

DBGET integrated database retrieval system