KEGG   Saccharomyces cerevisiae (budding yeast): YPL113CHelp
Entry
YPL113C           CDS       T00005                                 

Definition
(RefSeq) glyoxylate reductase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH IlvN ApbA
Motif
Other DBs
NCBI-GeneID: 855990
NCBI-ProteinID: NP_015212
SGD: S000006034
UniProt: Q02961
Position
XVI:complement(335953..337143)
Genome map
AA seq 396 aa AA seqDB search
MITSIDIADVTYSAKPRILVPYKTQWEVASHLPEYRKLAERVEFYKYEMSTKDDFVKFLE
THRINGFWLTEEFFTVLGNPSSYIEFFPASLKVILVPWVGCDFIDGKLLRSKGITLCNIG
PHAADHVTELAIFLAISCFRMTSFWEYCFKYVENGNVEQCKKYISSDSYEIVTDSYHGQE
MKFPSRTDKCKPNKDRKVVHLAEKYTVGGKKMESPMNKKVLILGFGSIGQNIGSNLHKVF
NMSIEYYKRTGPVQKSLLDYNAKYHSDLDDPNTWKNADLIILALPSTASTNNIINRKSLA
WCKDGVRIVNVGRGTCIDEDVLLDALESGKVASCGLDVFKNEETRVKQELLRRWDVTALP
HIGSTVADMVIKQTLITLENVQDIFVEGGDGKYVLN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattacttcaattgacatagcagatgtaacttattctgccaaaccaagaattttggtg
ccttataaaacccaatgggaagtcgccagtcatcttcctgaatatcgcaaactggcagaa
agggtagaattctataaatatgagatgtccacaaaggatgattttgttaaatttttggaa
actcatagaataaacggcttttggctcactgaggagtttttcactgtgttaggaaaccct
tcgagttatattgaattcttccccgcatctttaaaagtaatccttgtaccatgggtcggc
tgtgactttattgacggtaagttattaagatcgaaaggtatcactttatgcaacattgga
ccacatgctgctgaccatgtcacagaattggctattttcctagcaattagctgctttaga
atgacttcattttgggaatattgttttaaatacgtggaaaatggtaatgttgaacagtgt
aagaaatatatctctagtgactcgtatgaaattgttacagatagttaccacggtcaggaa
atgaaatttccctctcgaacagacaaatgcaagcctaacaaggataggaaagtggtacat
ttagcagaaaagtacacggttggcgggaaaaaaatggaatctccaatgaataaaaaagtt
ctaatattggggtttggctccatcggacaaaatatagggtctaacttgcacaaagtgttc
aacatgagcattgaatactacaaaaggaccggtcccgtccaaaagagtctacttgattac
aacgctaagtaccattctgatctagatgatccaaatacttggaagaatgcggatttgatc
attttggccttgcccagtacggcctctacaaacaatattatcaatcgtaaaagtttggcc
tggtgtaaagatggtgtcaggatagttaacgttgggagaggcacatgcatagatgaagat
gtgctactagacgctcttgaatctggaaaagtggcaagctgtggtctcgatgtgtttaaa
aatgaggaaacacgcgttaagcaagagttacttcgcagatgggatgttacagctttgcca
catatcggcagcacagttgccgacatggtcataaagcagacactcatcacactcgagaat
gtgcaggacatatttgtcgagggaggtgatggtaagtatgtgctcaactga

DBGET integrated database retrieval system