KEGG   Saccharomyces cerevisiae (budding yeast): YPL115CHelp
Entry
YPL115C           CDS       T00005                                 

Gene name
BEM3
Definition
(RefSeq) Bem3p
  KO
K19840  Rho-type GTPase-activating protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YPL115C (BEM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RhoGAP PX PH DUF1708 Cnn_1N
Motif
Other DBs
NCBI-GeneID: 855988
NCBI-ProteinID: NP_015210
SGD: S000006036
UniProt: P32873
Structure
PDB: 

Position
XVI:complement(332100..335486)
Genome map
AA seq 1128 aa AA seqDB search
MTDNLTTTHGGSTTLELLAQYNDHRSKKDKSIEHIEKGTCSGKERNPSYDEIFTENIKLK
LQVQEYETEIESLEKVIDMLQKNREASLEVVLEQVQNDSRDSYVNDQSFVLPPRSAERKA
HIKSLNLPIPTLSPPLQQGSDVALETSVTPTVPQIGVTSNTSISRKHLQNMILNDEIEAN
SSFSSPKIINRSVSSPTKIHSEQLASPAASVTYTTSRITIKSPNKGSKSPLQERLRSPQN
PNRMTAVINNHLHSPLKASTSNNLDELTESKSQQLTNDAIQKNDRVYSSITSSAYTTGTP
TSAAKSPSSLLEVKEGENKALGFSPASKEKLDDFTQLLDSSFGEEDLVNTDSKDPLSIKS
TINESLPPPPAPPTFFSPTSSGNIKNSTPLSSHLASPVILNKKDDNFGAQSAKNLKKPVL
TSSLPNLSTKLSTTSQNASLPPNPPVESSSKQKQLGETASIHSTNTLNTFSSTPQGSLKT
LRRPHASSVSTVKSVAQSLKSDIPLFVQPEDFGTIQIEVLSTLYRDNEDDLSILIAIIDR
KSGKEMFKFSKSIHKVRELDVYMKSHVPDLPLPTLPDRQLFQTLSPTKVDTRKNILNQYY
TSIFSVPEFPKNVGLKIAQFISTDTVMTPPMMDDNVKDGSLLLRRPKTLTGNSTWRVRYG
ILRDDVLQLFDKNQLTETIKLRQSSIELIPNLPEDRFGTRNGFLITEHKKSGLSTSTKYY
ICTETSKERELWLSAFSDYIDPSQSLSLSSSRNANDTDSASHLSAGTHHSKFGNATISAT
DTPSYVTDLTQEYNNNNNISNSSNNIANSDGIDSNPSSHSNFLASSSGNAEEEKDSRRAK
MRSLFPFKKLTGPASAMNHIGITISNDSDSPTSPDSIIKSPSKKLMEVSSSSNSSTGPHV
STAIFGSSLETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKT
LQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFL
SFKRVVDENHNNPVQISLGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRN
LCIVFSPTLNIPISMLQPFITDFACIFQGGEPVKEEEREKVDIHIPQV
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgacagataatttgaccacaactcatggtggtagtaccacccttgaattgttggcgcag
tacaatgatcatagatccaaaaaggacaaatctatagaacatatagaaaaaggaacatgt
tcaggaaaagaaagaaatccgtcctatgatgaaatttttacggaaaacattaagctaaag
ctacaagtccaagaatatgaaactgaaattgagagtttggaaaaggttattgatatgtta
caaaaaaacagagaagcttccttagaagttgtgcttgagcaagttcaaaatgactcaaga
gattcatacgttaacgatcaatcatttgtgttacccccaagatctgctgaaaggaaagcg
catatcaagagtcttaatttgccaataccgacattgtcccctccattgcaacaaggttca
gacgttgcacttgaaacaagtgtaacgcctacagtacctcaaataggtgttacatcaaat
acttcaataagtaggaagcatttacagaacatgatactaaacgatgaaatagaagcaaat
agtagcttctcatctcccaaaattatcaatagatctgtctcaagccctacaaaaatacat
tcagaacagttggctagcccagctgcctctgttacctatacgacgtctaggataaccata
aaatcacctaataaaggttcgaaatctccattgcaagaacgtttgcgttcccctcaaaat
cctaacagaatgacggctgttatcaacaaccatttgcattctccattaaaggccagtacc
tctaataatttagatgagctgactgaaagtaaaagtcaacaactaactaatgacgcgata
caaaaaaatgaccgcgtttattcttctataacatcctctgcatacactactggaactcct
acttcagcagccaaaagtccatcatcccttttggaagtcaaggagggtgaaaacaaggct
ttgggtttctctccagcatctaaagaaaaacttgacgacttcacccaattacttgactcc
tcatttggcgaagaggatctagtcaatacggacagtaaagatcctctgtccataaaatcc
acgattaacgaatctttacccccacctccagcgcctccaacttttttctcacctacttct
agtggaaatataaaaaactctactcctttatcaagccatttggcttctccggttatcttg
aataaaaaggatgataattttggtgctcaaagtgcaaaaaatttaaagaaacctgtgtta
acttcatcactccccaatctttctacaaaattgtcaacaacaagtcaaaatgcttctctt
cctccaaatcctcccgtggaaagttcatcaaaacaaaaacaacttggagaaacggcatcc
atccattcaaccaataccttgaatacatttagctcaacaccccaaggttcgttgaagaca
cttagaagacctcatgcaagtagcgtgagcaccgtgaagtctgtggcccaaagtcttaag
tcggatattccattattcgttcaaccggaggattttggcactatccagattgaagtactg
agcacattgtacagggataatgaagatgatttatccattttaattgcaatcatagacagg
aaatccggtaaggagatgtttaaattttcaaaatctattcataaagttcgcgaattagat
gtatatatgaaatcacatgttcccgatttaccattgcccacgttacctgatagacaatta
tttcagactttatcacctacaaaagtggatacgcgaaagaacatattgaatcagtattat
acaagcatattcagtgtccctgaatttcccaaaaatgttggtttaaaaatcgcccaattt
attagtacagatacagtaatgacacctccaatgatggatgataatgtgaaagacggatca
cttttgctgagaagaccaaagactctaacaggtaatagtacatggagagttcggtacggt
attttgcgcgatgatgttttacaattgtttgacaaaaatcagttgactgaaactattaaa
ttgagacaatcttctatagaacttatacccaatctccctgaagatagatttggaacgaga
aatgggtttttgatcactgagcataagaaaagcggactgtcaacctcaacaaagtattat
atttgtactgaaacgtcgaaggaacgtgaattatggctttctgcgtttagtgattacatt
gatccttcacaaagtttatcgttatctagctcgaggaatgcaaacgatactgattctgca
tctcacttgagcgcaggaacacaccattctaaatttggaaacgcaactatctcagcaacc
gatactccatcatatgtcactgatttgacccaagaatataataataataacaatattagt
aatagtagcaataacattgctaatagcgatggtattgactcaaacccatcttctcactct
aacttcctagcaagttcaagcgggaatgcagaggaggagaaggatagtaggagagccaaa
atgagaagtttattcccttttaaaaaattaaccggcccggcgagtgcaatgaaccatata
ggtattacaatttcaaatgattcggattctccaacatctcctgactctatcattaagtca
ccaagcaaaaaattaatggaagtatcctcttcgtcaaattcttctacgggtccacatgtg
tccactgcaatatttggctcgtcactagaaacgtgtttaagattgagttcgcataagtac
caaaacgtttacgatttaccgagtgtagtttatcgttgcttagagtatctttacaaaaac
cgtggtatccaggaagaaggcatatttagactaagcgggtccagtacagttatcaaaact
ttacaagaaaggtttgataaagagtacgatgtagatttatgtcggtacaatgaaagtatt
gaagctaaagatgatgaggcatctccaagtctttacattggtgtgaatactgtaagtggg
ttactaaagttgtacttgagaaagttgccccatttattatttggtgacgaacaatttttg
tcgtttaaaagagtagttgatgaaaatcataataatcctgttcaaatatcattggggttt
aaggaacttattgaatctggcctagttcctcacgctaacctatcgttgatgtatgctctt
tttgaactgctggtaaggatcaatgagaatagtaagtttaataagatgaatctaagaaat
ttatgcatcgtgttttccccaactctaaatattccaattagtatgcttcaaccattcatc
actgactttgcgtgtatatttcagggtggtgaaccagttaaagaagaggaaagggagaaa
gtagatatacatattcctcaggtttga

DBGET integrated database retrieval system