KEGG   Saccharomyces cerevisiae (budding yeast): YPL117CHelp
Entry
YPL117C           CDS       T00005                                 

Gene name
IDI1, BOT2, LPH10
Definition
(RefSeq) isopentenyl-diphosphate delta-isomerase IDI1
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00900  Terpenoid backbone biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Module
sce_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
sce_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPL117C (IDI1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     YPL117C (IDI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX DUF4459
Motif
Other DBs
NCBI-GeneID: 855986
NCBI-ProteinID: NP_015208
SGD: S000006038
UniProt: P15496
Position
XVI:complement(327864..328730)
Genome map
AA seq 288 aa AA seqDB search
MTADNNSMPHGAVSSYAKLVQNQTPEDILEEFPEIIPLQQRPNTRSSETSNDESGETCFS
GHDEEQIKLMNENCIVLDWDDNAIGAGTKKVCHLMENIEKGLLHRAFSVFIFNEQGELLL
QQRATEKITFPDLWTNTCCSHPLCIDDELGLKGKLDDKIKGAITAAVRKLDHELGIPEDE
TKTRGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKINAKENLTVNPNVNEVRDFKWVSPN
DLKTMFADPSYKFTPWFKIICENYLFNWWEQLDDLSEVENDRQIHRML
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgacaacaatagtatgccccatggtgcagtatctagttacgccaaattagtg
caaaaccaaacacctgaagacattttggaagagtttcctgaaattattccattacaacaa
agacctaatacccgatctagtgagacgtcaaatgacgaaagcggagaaacatgtttttct
ggtcatgatgaggagcaaattaagttaatgaatgaaaattgtattgttttggattgggac
gataatgctattggtgccggtaccaagaaagtttgtcatttaatggaaaatattgaaaag
ggtttactacatcgtgcattctccgtctttattttcaatgaacaaggtgaattactttta
caacaaagagccactgaaaaaataactttccctgatctttggactaacacatgctgctct
catccactatgtattgatgacgaattaggtttgaagggtaagctagacgataagattaag
ggcgctattactgcggcggtgagaaaactagatcatgaattaggtattccagaagatgaa
actaagacaaggggtaagtttcactttttaaacagaatccattacatggcaccaagcaat
gaaccatggggtgaacatgaaattgattacatcctattttataagatcaacgctaaagaa
aacttgactgtcaacccaaacgtcaatgaagttagagacttcaaatgggtttcaccaaat
gatttgaaaactatgtttgctgacccaagttacaagtttacgccttggtttaagattatt
tgcgagaattacttattcaactggtgggagcaattagatgacctttctgaagtggaaaat
gacaggcaaattcatagaatgctataa

DBGET integrated database retrieval system