KEGG   Saccharomyces cerevisiae (budding yeast): YPL119CHelp
Entry
YPL119C           CDS       T00005                                 

Gene name
DBP1, LPH8
Definition
(RefSeq) putative DEAD-box ATP-dependent RNA helicase DBP1
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPL119C (DBP1)
   03041 Spliceosome [BR:sce03041]
    YPL119C (DBP1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YPL119C (DBP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YPL119C (DBP1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YPL119C (DBP1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YPL119C (DBP1)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    YPL119C (DBP1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    YPL119C (DBP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C CMS1
Motif
Other DBs
NCBI-GeneID: 855984
NCBI-ProteinID: NP_015206
SGD: S000006040
UniProt: P24784
Position
XVI:complement(324411..326264)
Genome map
AA seq 617 aa AA seqDB search
MADLPQKVSNLSINNKENGGGGGKSSYVPPHLRSRGKPSFERSTPKQEDKVTGGDFFRRA
GRQTGNNGGFFGFSKERNGGTSANYNRGGSSNYKSSGNRWVNGKHIPGPKNAKLEAELFG
VHDDPDYHSSGIKFDNYDNIPVDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPV
QKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSA
LVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLND
LLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDI
QHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVET
KRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNV
THVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTF
LSDLSRQNSRGGRTRGGGGFFNSRNNGSRDYRKHGGNGSFGSTRPRNTGTSNWGSIGGGF
RNDNEKNGYGNSNASWW
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttgccacagaaggtatctaatttaagcatcaacaacaaagagaatggtggt
ggtggcggcaaatcatcttatgtcccaccgcacttgagaagtagaggaaaaccatcattc
gaaagaagtaccccaaaacaggaagataaggttacgggtggtgattttttcagacgtgct
ggaaggcaaactgggaacaatggcgggttttttggcttttctaaggaaagaaatggaggg
acgagtgcgaactataaccgcggaggcagctcaaattacaaatcatctggaaatagatgg
gtaaatggcaagcatataccggggcctaagaacgcgaaattagaagccgaactgtttggt
gtacacgacgatcccgattaccattcatctggtataaagtttgataattacgataatatt
cccgtagatgcatctggaaaagatgttcctgaacctatactagattttagttctccccct
ctggatgagctgttaatggaaaatatcaaacttgctagtttcaccaaacctactccagta
caaaaatattctattccaatagttaccaaaggtagggatttgatggcatgcgcacaaacg
ggctcaggtaagacaggtgggtttttgtttccgctcttcacggagctattcaggtctggg
ccctctccagtacccgagaaagcacagagcttttattctagaaagggatatccatctgct
ttagtacttgcaccaactagagaattggctacccaaatttttgaagaagcaagaaaattt
acgtatagatcttgggttaggccatgcgttgtttatggtggcgcgccaatcggtaaccag
atgagggaggttgaccgcggctgtgacttattggtggctacaccagggcggctgaatgac
ttattagaacgcggaaaagtttctttggctaatatcaaatacctggtattggatgaggct
gatagaatgctagatatgggattcgaaccccaaattcgccatatagttgaagaatgtgat
atgccctctgtggaaaatagacagaccttgatgttttccgccacattcccagtagatatc
cagcatttggcacgcgatttcttagataattatatttttttatcagtaggaagagtcggt
tccacctcagaaaatatcacgcaaagaatattatatgtcgatgacatggacaaaaagtct
gcgttgttagatttactgtctgcagagcataagggattgacattgatttttgttgaaacg
aaaagaatggcggatcaactcacagattttttgatcatgcaaaatttcaaagctacagcc
atacatggtgaccgcacacaggctgaacgtgaacgtgccttatctgctttcaaagctaac
gtagctgatatcctggtcgcaacagctgtagcagcgagaggtttggatataccgaatgtc
acacatgtcattaattatgatttgccctccgacatcgatgactacgttcacagaattggt
agaacaggccgtgctggtaacacaggcgtggctacttcattcttcaatagtaataatcag
aatattgtgaagggtttgatggaaattttaaatgaagcgaatcaagaagttcccacgttt
ttaagtgacctgtcaagacagaattcaagaggtggaagaactaggggaggaggaggtttt
ttcaatagtcgtaataacggttcaagagactaccgtaaacatggtggaaatggctcattt
gggagcacgaggccaaggaatactggaacatcaaattggggttcgattggaggtgggttt
agaaatgataatgagaaaaacggttacggaaatagcaacgcttcatggtggtaa

DBGET integrated database retrieval system