KEGG   Saccharomyces cerevisiae (budding yeast): YPL120WHelp
Entry
YPL120W           CDS       T00005                                 

Gene name
VPS30, APG6, ATG6, VPT30
Definition
(RefSeq) beclin 1
  KO
K08334  beclin
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YPL120W (VPS30)
   04136 Autophagy - other
    YPL120W (VPS30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPL120W (VPS30)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YPL120W (VPS30)
Membrane trafficking [BR:sce04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    YPL120W (VPS30)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    YPL120W (VPS30)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APG6 APG6_N
Motif
Other DBs
NCBI-GeneID: 855983
NCBI-ProteinID: NP_015205
SGD: S000006041
UniProt: Q02948
Structure
PDB: 

Position
XVI:322071..323744
Genome map
AA seq 557 aa AA seqDB search
MKCQTCHLPLQLDPSLEGLSLTQRNLLLSNNSIITATNENVISNKGIEAADNCGPQIPKE
RLRRLGEIQNIKDLNLKDDKLITDSFVFLNHDDDDNANITSNSREDQRYGNANGNDNKKA
NSDTSDGTSTFRDHDEEEQEATDEDENQQIQLNSKTLSTQVNAMTNVFNILSSQTNIDFP
ICQDCCNILINRLKSEYDDAIKERDTYAQFLSKLESQNKEISESNKEKQYSHNLSEKENL
KKEEERLLDQLLRLEMTDDDLDGELVRLQEKKVQLENEKLQKLSDQNLMDLNNIQFNKNL
QSLKLQYELSLNQLDKLRKINIFNATFKISHSGPFATINGLRLGSIPESVVPWKEINAAL
GQLILLLATINKNLKINLVDYELQPMGSFSKIKKRMVNSVEYNNSTTNAPGDWLILPVYY
DENFNLGRIFRKETKFDKSLETTLEIISEITRQLSTIASSYSSQTLTTSQDESSMNNAND
VENSTSILELPYIMNKDKINGLSVKLHGSSPNLEWTTAMKFLLTNVKWLLAFSSNLLSKS
ITLSPTVNYNDKTISGN
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgccaaacatgtcacttacccctgcaactagacccatctttagaaggtcttagt
ttaacccaaagaaatttgctactttcaaataattcaattatcactgcaacgaatgaaaat
gtcatcagcaacaagggcatcgaagccgcagataattgtgggcctcaaataccgaaggag
aggctgaggcgattaggggagattcagaacataaaagacttgaatttaaaagatgataaa
ttaatcactgattcgtttgtttttcttaatcacgatgatgatgataatgctaatattacg
agtaatagcagagaggaccagcgttatggaaatgccaacggaaatgataataaaaaagct
aatagtgatacttccgatggaaccagtacctttcgagatcatgacgaagaggaacaagaa
gctacggatgaggacgaaaaccaacaaatacaattgaattccaagactttgtccacacaa
gtcaacgcaatgactaatgtatttaacattctatcttctcaaacaaacatagactttcct
atctgtcaggactgctgtaacatcttgataaacagactaaaaagtgagtatgatgatgca
ataaaagagagagatacttacgctcaatttttatcgaagttagagagtcaaaacaaagaa
atatcagaaagcaataaagaaaagcagtattcccataatctttcggaaaaagaaaatttg
aaaaaggaagaggaaagactcttggatcaattattacgtttggaaatgacagatgatgac
ttagatggagaactagttcgtttacaagaaaagaaagttcaactggaaaatgagaaactc
caaaaactgagtgatcagaatttaatggatttaaataacattcaattcaacaaaaattta
cagtcattaaaactgcaatacgaattatccttgaatcaattagataagttgaggaaaatc
aatattttcaatgctacattcaaaatctcacatagcggcccctttgccactataaatgga
ttgagattaggcagtataccagaatcagtggtaccttggaaggaaatcaatgcagcactg
ggccaattgattcttttactggctaccataaacaaaaacctgaagataaatttagtagac
tacgaattacaaccgatgggttcattttccaaaatcaagaaaagaatggttaacagtgtc
gaatataataattccactacgaacgctcccggtgattggttgattctgcctgtctactat
gatgagaatttcaatttggggagaatcttccgcaaggaaacgaagtttgataaatcatta
gaaacaacattagaaataataagcgaaatcactcggcagctttctacgatagcgtcatca
tattcatctcaaacactcacaacaagccaagatgaatcttcaatgaataacgcaaatgac
gttgaaaatagtacttccattctcgagctaccctatatcatgaataaggacaagattaat
ggattatccgtcaaattgcatggtagcagtcccaaccttgaatggacaacggctatgaaa
tttttattaaccaatgtaaagtggttgttagcgttttcttccaatttactatccaagtca
attaccttaagccctacagtgaattacaatgataagaccatcagcggaaactaa

DBGET integrated database retrieval system