KEGG   Saccharomyces cerevisiae (budding yeast): YPL123CHelp
Entry
YPL123C           CDS       T00005                                 

Gene name
RNY1
Definition
(RefSeq) ribonuclease T2
  KO
K01166  ribonuclease T2 [EC:4.6.1.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YPL123C (RNY1)
Enzymes [BR:sce01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.19  ribonuclease T2
     YPL123C (RNY1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    YPL123C (RNY1)
 Prokaryotic Type
    YPL123C (RNY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_T2
Motif
Other DBs
NCBI-GeneID: 855980
NCBI-ProteinID: NP_015202
SGD: S000006044
UniProt: Q02933
Position
XVI:complement(317641..318945)
Genome map
AA seq 434 aa AA seqDB search
MLLKNLHSLLQLPIFSNGADKGIEPNCPINIPLSCSNKTDIDNSCCFEYPGGIFLQTQFW
NYFPSKNDLNETELVKELGPLDSFTIHGLWPDNCHGGYQQFCNRSLQIDDVYYLLHDKKF
NNNDTSLQISGEKLLEYLDLYWKSNNGNHESLWIHEFNKHGTCISTIRPECYTEWGANSV
DRKRAVYDYFRITYNLFKKLDTFSTLEKNNIVPSVDNSYSLEQIEAALSKEFEGKKVFIG
CDRHNSLNEVWYYNHLKGSLLSEMFVPMDSLAIRTNCKKDGIKFFPKGYVPTFRRRPNKG
ARYRGVVRLSNINNGDQMQGFLIKNGHWMSQGTPANYELIKSPYGNYYLRTNQGFCDIIS
SSSNELVCKFRNIKDAGQFDFDPTKGGDGYIGYSGNYNWGGDTYPRRRNQSPIFSVDDEQ
NSKKYKFKLKFIKN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttactgaaaaacttacacagtctcttacaactaccaattttttcgaatggagcagat
aagggtatagaaccaaactgccctataaacattccattatcatgttccaataaaactgat
atagacaactcgtgttgttttgaatatccaggtggaatatttttacaaacccaattctgg
aattactttccaagcaaaaacgatttaaatgaaactgaattagtgaaggagttagggcct
ctagattcatttacaattcacggattatggccagataattgtcatggtggctaccaacaa
ttctgtaataggtccttacaaattgacgatgtttactacttattgcatgacaagaaattt
aataataatgatacatccctgcaaatatcgggcgaaaagctgcttgaatacctagactta
tattggaagagtaataacgggaatcatgagtccttatggatacacgagtttaataaacat
ggcacgtgcattagcacaattagaccagagtgctatactgagtggggtgctaatagtgtt
gacagaaaaagagcggtctatgattattttagaataacttataatctattcaagaaattg
gacacattttcaacactagaaaaaaataatattgtcccaagtgtggacaattcctattct
ttggagcagatagaggcagcactaagtaaagagtttgaaggaaaaaaagtcttcataggc
tgtgatagacataattccttaaacgaagtatggtattataaccacttgaagggttccctt
ttgagcgaaatgtttgtgcccatggactcacttgccattcgaacaaattgtaaaaaagat
ggtattaagttttttccaaaaggttatgtcccaactttcaggaggagacctaataaggga
gcaagatacagaggagtcgttcgtctatcaaatattaataatggagatcagatgcaaggc
tttctaatcaagaatggacactggatgagtcaaggtacaccagcgaattacgagttgatt
aaatctccctatgggaattactacttgagaactaaccaagggttttgtgacattatttcg
tcttcatctaatgaattggtctgcaaattcaggaacattaaggatgcaggtcaattcgat
tttgatccaacgaaaggaggagacggatatattggttattctggtaactacaactggggc
ggtgacacctatccaaggagaaggaatcaaagccccattttctctgtagacgatgaacaa
aattccaagaaatataagtttaaattaaaattcatcaaaaattaa

DBGET integrated database retrieval system