KEGG   Saccharomyces cerevisiae (budding yeast): YPL127CHelp
Entry
YPL127C           CDS       T00005                                 

Gene name
HHO1
Definition
(RefSeq) histone H1
  KO
K11275  histone H1/5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YPL127C (HHO1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    YPL127C (HHO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Linker_histone WAPL
Motif
Other DBs
NCBI-GeneID: 855976
NCBI-ProteinID: NP_015198
SGD: S000006048
UniProt: P53551
Structure
PDB: 

Position
XVI:complement(308828..309604)
Genome map
AA seq 258 aa AA seqDB search
MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKTTAKKEEASSKSYRELIIEGLTALKE
RKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKS
PEVKKEKEVSPKPKQAATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTY
KEMILKSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENGELVQP
KGPSGIIKLNKKKVKLST
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaagaaatccactaccaagaccacaagtaagggcaagaagcctgcaaccagc
aaaggcaaggagaaatcaacttccaaggccgctatcaagaaaaccacggcaaaaaaggag
gaagcttcctccaagagttacagggagttgatcattgaagggctcacggctttgaaggaa
cgtaagggatccagtcgtccggcactcaagaagtttatcaaggaaaactacccgatcgtc
ggatccgcaagcaactttgatttgtacttcaacaatgccataaagaagggtgtggaggcc
ggcgattttgaacagccaaagggacccgctggtgctgtgaaactggccaagaagaaatct
ccagaagtaaagaaagaaaaagaggtcagtccaaaacccaagcaagccgccacttctgtg
agtgcaaccgcatcaaaagcgaaagccgcatccacgaagctagcgccaaagaaagtagtg
aaaaaaaaatcgcctactgttaccgccaagaaggcctcttcgccttcttcattgacctac
aaggaaatgatccttaaaagcatgcctcaacttaatgacggtaagggctccagccgtatc
gttttaaagaagtatgtcaaggacactttctcctccaagttgaaaacaagctcaaatttt
gactatctgttcaatagcgctatcaagaaatgtgttgaaaacggcgagttagtgcaacca
aagggcccctccggcattattaaactaaacaagaagaaggtcaaactctccacgtaa

DBGET integrated database retrieval system