KEGG   Saccharomyces cerevisiae (budding yeast): YPL128CHelp
Entry
YPL128C           CDS       T00005                                 

Gene name
TBF1, LPI16
Definition
(RefSeq) Tbf1p
  KO
K22485  protein TBF1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YPL128C (TBF1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     YPL128C (TBF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRF Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 855975
NCBI-ProteinID: NP_015197
SGD: S000006049
UniProt: Q02457
Position
XVI:complement(306533..308221)
Genome map
AA seq 562 aa AA seqDB search
MDSQVPNNNESLNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVL
TDQTAFLSSGETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHE
AFIITAIRKANLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNTVGNNSLEQSGKFLKSQ
AILYLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITL
LTPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRG
KSPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSS
KNPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEAL
VEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIK
VTGNLEKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPS
NGLFGNSTSDNTGFDPHLEDGM
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggattcgcaagtgcccaataataacgaaagcttaaaccgcttcaatgacatcatccaa
agcctgcctgcaagaactaggttgaccatatgctcattatgtctgctggacaatatctcc
actcaactactgaggtttcttatccttaatgccaactctcccaatattatagcggttttg
acggaccagacggctttcctaagctcaggcgaaacagaaatttttcaaacgttagtcaag
ctctttaagcagatcagaatgatttaccacaccagatctccgttactgtctgttcacgac
gtggcgcctggtttatggtttcccaactcccctcccccccttatattgagaggccacgaa
gcgtttattattactgccataagaaaggcgaatctgctaacatttctattgacgtcgctg
aactgccttaattacgggtttgagctgctacagtcgatatttctcgatattttctgtcca
aatacaaacactgtcggtaacaactccctggaacaaagcggaaagtttttgaaatcgcag
gctatcctatatcttgatctgaaaacacaggcttacattgccggcttgaaagagtttcag
gacgagacgaacgaaatttctttagaaaagaaacaagagctactagacttaatcttccca
tccaatctggctgatattctcgtgcagagaagaaccggcgattctggagacattacactt
ttgactccatcggagaaggacttcgtcgaaaggtgcgatcgtcggagagaaaatttaaag
atcgtccaagattttaactctctgacccagagctacgaatgggctcaatttatcagagag
ttgctggattattgtaataaaaatatgggtctcatcatatggggcagaaagggtcgcgga
aaatcaccattatatgactttgatgtcaacgagtttgatcctcaagtactcttttctaca
gggaccaggaccgtagaattcatggacgaccaaaatcagccaagcagtgcgtctgctttt
ttgtcaactgctcgtccgaatcattacagcacacatacacctaccacagatgtgtcttcc
aaaaaccccgctatcacacaatccattgtggatgccgctgttgcggcctcgatgagcaac
agcagctctggtcctcattcctctcataacaacagcagtaacagcaacaataatggtagt
atcggattaagaaaaccaaaggcgaaaagaacttggtccaaagaggaagaagaagcatta
gtggaaggcctgaaagaggttggcccatcgtggtctaagattctagatttatatggtccc
ggtggtaaaatcacggaaaatttgaagaacaggacgcaggtacaactgaaagataaagcc
cgtaattggaaattacaatacttgaagagtggcaaaccattgcctgactatttgataaaa
gtgaccggtaacttggagaaaatctacaaggcaaagaaaaaattctctcaatctccaaat
tcgtcaactattatggaacaaaatttatctcagcatccttcatcagctgcatctgctact
gaagacactcaaactcatcaagaggattcacatgggcaaaatagtgataatatgccatct
aacggactttttggcaatagtacatcggacaatacaggttttgatcctcatttagaagat
gggatgtag

DBGET integrated database retrieval system