KEGG   Saccharomyces cerevisiae (budding yeast): YPL131WHelp
Entry
YPL131W           CDS       T00005                                 

Gene name
RPL5, LPI14, RPL1
Definition
(RefSeq) ribosomal 60S subunit protein L5
  KO
K02932  large subunit ribosomal protein L5e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YPL131W (RPL5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YPL131W (RPL5)
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YPL131W (RPL5)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YPL131W (RPL5)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YPL131W (RPL5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5e Ribosomal_L18_c Ribosomal_L18p Thr_synth_N Com_YlbF NAC DAG_kinase_N
Motif
Other DBs
NCBI-GeneID: 855972
NCBI-ProteinID: NP_015194
SGD: S000006052
UniProt: P26321
Position
XVI:303121..304014
Genome map
AA seq 297 aa AA seqDB search
MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI
ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK
GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggctttccaaaaagacgctaagtcctctgcttactcctctcgtttccaaactcctttc
agaagaagaagagaaggtaagactgattactaccaaagaaagagattggtcacccaacac
aaggccaagtacaacactccaaagtacagattggttgttagattcactaacaaggatatc
atctgtcaaatcatctcttctaccatcactggtgatgtcgtcttagctgctgcctactcc
cacgaattgccaagatacggtattacccacggtttgaccaactgggctgctgcttacgct
actggtttgttgatcgccagaagaaccttgcaaaagttgggtttggacgaaacttacaag
ggtgttgaagaagttgaaggtgaatacgaattgaccgaagctgttgaagatggtccacgt
ccattcaaggtcttcttggatattggtttgcaaagaaccaccactggtgccagagttttc
ggtgctctaaagggtgcttctgacggtggtttgtacgttcctcactccgaaaacagattc
ccaggttgggacttcgaaaccgaagaaattgacccagaattattgagatcttacatcttt
ggtggccacgtttcccaatacatggaagaattagctgacgatgatgaagaaagattctct
gaattattcaagggttacctagctgacgacattgatgctgactctttggaagacatctac
acttctgctcacgaagctatcagagctgacccagctttcaagccaactgaaaagaaattc
accaaggaacaatacgctgctgaatccaagaagtacagacaaaccaaattgtccaaggaa
gaaagagctgctcgtgttgctgccaagatcgctgctttggctggtcaacaataa

DBGET integrated database retrieval system