KEGG   Saccharomyces cerevisiae (budding yeast): YPL137CHelp
Entry
YPL137C           CDS       T00005                                 

Gene name
GIP3
Definition
(RefSeq) protein phosphatase regulator GIP3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 855967
NCBI-ProteinID: NP_015188
SGD: S000006058
UniProt: Q03016
Position
XVI:complement(292817..296647)
Genome map
AA seq 1276 aa AA seqDB search
MITNTEFDVPVDWLYKGKSRRKTNTKPSRPSTSPASSSSTSSSKNGDNSTSGNRSSNDKP
RARSSSVSNAALCNTEKPDLKRNDGNTSASDTDNIPLLTPINSGNRSDSADIDNPATVDA
IDLIDNDDNGSSTQFVRKKRSTSISNAVVSSKPRLASSAINATASSSVGKGKHPPISSPS
NATLKRSNSTSGEKTKRSIFGSLFSKRSTSSSASTAKKPLPVVNTSTTENESGGIKAVAT
PDPRVKEISSPMRGVAPTASKPQTPILPSPALAVKDLSTVSLKRVSFAVDKFESDPPQQL
PSRTPKKGNILIPDDMISEVPSISVGISSSNQSAKSTNSNIKGPLYTKKSKEYILALENQ
KLALREAAKHQQEAHFAANRIAFEVANFKTASDAGGKLTEKSSEGTITKQREEVSPPNVE
ADRELENNKLAENLSKAGIDKPIHMHEHYFKEPDQDKYQDGHSIENNEVTLDVIYTRCCH
LREILPIPSTLRQVKDKTAPLQILKFLNPKPTLIDILSFCDFITIAPIHTIVFDNVALNQ
DMFRIIISALVNSTVLDKLSLRNVRIDQDGWKLLCKFLLLNKSLNKLDISQTKIKSDLAE
SLYRHNMDWNLFTDVLSQRSHKPIEELLFNGIQFSKIPYSCFARLLTSFATQKNFPESGI
RLGLAGATTSNISQDCLKFIFNWMSQYNVQGVDLAFNDLSTMIKPMVGKLSALSYDNLRY
FILNSTNISTSYDLALLLKYLSKLPNLIFLDLSNLSQCFPDILPYMYKYLPRFPNLKRIH
LDSNNLTLKELAVVCNILIKCKSLSHVSMTNQNVENFYLMNGTDSPVQQTNTDGDLDSSS
TLDVKGQFAKNSFSSTLYAFARDSPNLIGLDFDYDLISEEIQSRIALCLMRNMKRTMDST
FQLDELDSQDDLLFDGSLVTMTAESVLEKLNLLSDKSTKVKKDTTKRYLLKKYIEKFHIL
HHNVQHTIDTMFEKRKSGELPLQEKENLVRLLLLEQNLCNILELFSHNPNLNDVLGSSRD
DSKESVDSSEDSKLPALKHVESGYHVPEEKIQPENDVITARPHLMATDSGKTIDVFTGKP
LVFKHTSSSTSVGCKKQEEEEGELHKWGFFVQQQRSLYPENESTRQTPFASGDTPINTET
AGKSTSSPSVSTSNNETATTSLFSPANPKILPKIPSGAVLRSAIMKAKGIDSIDDLIQNV
NSNNIELENIYGESIQNSASTFTPGVDSDVSAPNTDKGSVETLPAVSTDDPNCEVKVTAT
YDKLLNNLSMERSIRL
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgataactaacaccgagttcgatgtgcccgtagattggttgtataaaggtaagagtaga
cggaagacaaatacgaagccatcgaggccttctacgtcgccagcctcctcttcatctacg
tcctcttcgaaaaacggagacaatagcacgagtggtaacaggtctagcaatgataagcct
cgtgcgaggtcgtcatctgtatccaatgcagcactttgtaatactgagaaaccagatttg
aagaggaacgatggtaatacctctgcatcagacactgataacataccgctacttactcct
attaatagcggtaaccggagcgattccgctgacattgataatccggctaccgtagacgcc
atagaccttatagataatgatgacaacggctcaagtactcaatttgtaaggaaaaaacgt
tccacttctatatccaatgctgtggtctcgtccaaaccaagactggccagttctgccata
aacgccaccgcatcttcttctgttggcaagggaaagcacccgccaatttcttcaccatct
aatgctactctcaagagaagcaactcgactagtggagaaaagactaaaaggtcgattttt
ggatctttgtttagcaaacggtctacctcttcttcagcttccactgccaagaaaccatta
cctgttgttaatactagcacgactgagaatgagtctggtggcattaaagcagttgcgact
cctgatccacgggtgaaggagatatcatcaccaatgagaggagtggcaccaacagctagc
aagccacagacacctatactcccctcccctgcacttgcagtaaaagacctatctacagtt
tcattgaaaagggtctcgtttgccgtcgataaattcgaatccgatcctccccaacaactt
ccttcaagaaccccaaaaaagggaaacatccttatccctgatgacatgataagcgaggtt
ccttctatttccgtgggtatttccagtagcaaccaatcggccaagtcaaccaattccaac
attaagggaccgttgtacactaagaagtctaaagaatatatactcgccctggaaaatcaa
aagttggctttaagggaggctgctaagcatcagcaagaagctcattttgctgctaataga
atagcctttgaagtagccaattttaagactgcttcggatgcaggcggtaagcttactgaa
aagtcatcagaaggcaccattacgaagcaaagagaagaggtgtcacctccaaatgttgaa
gctgatcgggagcttgagaataataaacttgcagaaaacctctcaaaagccggcattgat
aagcccattcatatgcatgagcactatttcaaggaacctgatcaagataagtaccaagac
ggtcattctattgaaaataacgaagttacgctggatgttatttacacaagatgctgccat
ttaagggaaattttacccattccgtctaccctaagacaagtaaaggacaagacagctccc
ttgcaaatattgaagtttttgaaccctaagcctaccttgatcgatattctttccttttgt
gatttcatcaccattgctcccattcacacgattgttttcgacaatgtagctttaaaccag
gatatgttcagaataattatttctgctttggtaaactccacagttttggacaaattgagt
ttaagaaatgtacgaatcgaccaagatggatggaaattactatgtaagttccttttgcta
aacaaatcactgaacaagctcgacatttcccaaacgaaaatcaaatctgaccttgctgaa
tcactatatcgccataacatggattggaacttgtttactgacgtcttgtctcagagatct
cacaaacctatagaagaattgttattcaatggtattcaatttagcaaaattccttactca
tgctttgcacgtttactgacatcctttgctacccaaaaaaactttccagaatcgggcatc
aggcttggtttagcaggtgccactacttccaatatctctcaggattgtctgaaatttatc
ttcaattggatgtctcaatataacgtccagggtgtggatctagcgtttaatgatctgtcc
actatgattaagccaatggttggtaaactatctgctctatcatatgataacttaagatat
ttcattttgaacagcactaatatttcgacttcttatgatttagctttgctcttgaaatat
ctttctaagttgcctaacttgatttttttggatttgagtaatttgtcgcaatgctttcct
gacattttaccctacatgtacaagtatttaccaagatttccgaacctgaagaggatacat
ttggatagcaataatttgacattaaaggaactagctgtcgtttgtaatattttgattaag
tgcaaatcgctctcgcatgtgtcaatgactaatcaaaacgttgaaaacttctatctaatg
aacggcacagattctcccgttcaacaaactaacacagacggcgacttggatagttcgagc
acattggacgttaagggccaatttgctaaaaatagtttttcatccacactttacgcattt
gctagagactctccaaacttgattggtttagattttgactatgatttgatatcagaagag
attcaatcaagaatagcactgtgcttgatgagaaatatgaaacggaccatggattcgact
ttccagttagatgaattggattcgcaagatgatttgctattcgatggctctttagtaact
atgaccgctgaaagtgttttagaaaaactgaacttgttaagcgataagagtacaaaggtc
aaaaaagacaccacgaagagatatttgctgaaaaaatatattgaaaagttccatatcttg
caccataatgttcagcatacaatagatactatgttcgaaaaaaggaaatcaggtgaattg
ccattgcaagaaaaagaaaaccttgtaagattactccttttggaacaaaacttatgcaat
atactagaattgttttcgcataatccgaatctgaatgatgtccttggatccagcagggat
gattcgaaggaaagtgttgactccagcgaagattcaaaattaccagcattgaagcacgtt
gaatccggataccatgttcccgaagaaaaaatacaacctgagaatgatgtaattacagca
agaccacatttaatggccaccgattctggtaaaactattgacgttttcacaggcaaacca
ttggtgttcaagcatacatcatctagtacttctgtaggttgtaaaaagcaggaagaagaa
gaaggtgaactacataaatggggtttcttcgttcagcagcagaggtctttataccctgaa
aatgaatcaacaaggcagacaccttttgcatcaggtgatacgcctatcaacacagaaaca
gctggtaagtcaacttcatctccttcagtttcaacttctaacaatgaaactgctaccact
agtttatttagcccagctaatcctaagattttaccaaaaattccatccggtgctgtctta
agatcggcaatcatgaaggctaaaggtattgattctatcgatgatttgattcagaacgtt
aactccaacaacatagaattggagaacatttatggtgaatccattcagaatagcgcttcg
acatttacaccaggcgtggattctgatgtatctgcgcccaataccgataaaggatccgta
gaaacattgcctgcagtctcaactgacgacccaaattgtgaagtcaaagtcactgctacc
tatgacaaactattaaataatttgtcgatggagaggtcaatcagactttga

DBGET integrated database retrieval system