KEGG   Saccharomyces cerevisiae (budding yeast): YPL154CHelp
Entry
YPL154C           CDS       T00005                                 

Gene name
PEP4, PHO9, PRA1, yscA
Definition
(RefSeq) proteinase A
  KO
K01381  saccharopepsin [EC:3.4.23.25]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YPL154C (PEP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YPL154C (PEP4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.25  saccharopepsin
     YPL154C (PEP4)
Peptidases and inhibitors [BR:sce01002]
 Aspartic peptidases
  Family A1: pepsin family
   YPL154C (PEP4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp TAXi_N Asp_protease_2 gag-asp_proteas
Motif
Other DBs
NCBI-GeneID: 855949
NCBI-ProteinID: NP_015171
SGD: S000006075
UniProt: P07267
Structure
PDB: 

Position
XVI:complement(259714..260931)
Genome map
AA seq 405 aa AA seqDB search
MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEK
ANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSN
ECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAE
ATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTE
NGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI
TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGS
CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcttgaaagcattattgccattggccttgttgttggtcagcgccaaccaagtt
gctgcaaaagtccacaaggctaaaatttataaacacgagttgtccgatgagatgaaagaa
gtcactttcgagcaacatttagctcatttaggccaaaagtacttgactcaatttgagaaa
gctaaccccgaagttgttttttctagggagcatcctttcttcactgaaggtggtcacgat
gttccattgacaaattacttgaacgcacaatattacactgacattactttgggtactcca
cctcaaaacttcaaggttattttggatactggttcttcaaacctttgggttccaagtaac
gaatgtggttccttggcttgtttcctacattctaaatacgatcatgaagcttcatcaagc
tacaaagctaatggtactgaatttgccattcaatatggtactggttctttggaaggttac
atttctcaagacactttgtccatcggggatttgaccattccaaaacaagacttcgctgag
gctaccagcgagccgggcttaacatttgcatttggcaagttcgatggtattttgggtttg
ggttacgataccatttctgttgataaggtggtccctccattttacaacgccattcaacaa
gatttgttggacgaaaagagatttgccttttatttgggagacacttcaaaggatactgaa
aatggcggtgaagccacctttggtggtattgacgagtctaagttcaagggcgatatcact
tggttacctgttcgtcgtaaggcttactgggaagtcaagtttgaaggtatcggtttaggc
gacgagtacgccgaattggagagccatggtgccgccatcgatactggtacttctttgatt
accttgccatcaggattagctgaaatgattaatgctgaaattggggccaagaagggttgg
accggtcaatatactctagactgtaacaccagagacaatctacctgatctaattttcaac
ttcaatggctacaacttcactattgggccatacgattacacgcttgaagtttcaggctcc
tgtatctctgcaattacaccaatggatttcccagaacctgttggcccactggccatcgtt
ggtgatgccttcttgcgtaaatactattctatttacgatttgggcaacaatgcggttggt
ttggccaaagcaatttga

DBGET integrated database retrieval system