KEGG   Saccharomyces cerevisiae (budding yeast): YPL226WHelp
Entry
YPL226W           CDS       T00005                                 

Gene name
NEW1
Definition
(RefSeq) New1p
  KO
K03235  elongation factor 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YPL226W (NEW1)
Translation factors [BR:sce03012]
 Eukaryotic type
  Elongation factors
   YPL226W (NEW1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 Chromo AAA_29 MMR_HSR1 RsgA_GTPase AAA_22 AAA_23 MeaB AAA_16 DUF87 Apis_Csd
Motif
Other DBs
NCBI-GeneID: 855875
NCBI-ProteinID: NP_015098
SGD: S000006147
UniProt: Q08972
Position
XVI:121767..125357
Genome map
AA seq 1196 aa AA seqDB search
MPPKKFKDLNSFLDDQPKDPNLVASPFGGYFKNPAADAGSNNASKKSSYQQQRNWKQGGN
YQQGGYQSYNSNYNNYNNYNNYNNYNNYNNYNKYNGQGYQKSTYKQSAVTPNQSGTPTPS
ASTTSLTSLNEKLSNLELTPISQFLSKIPECQSITDCKNQIKLIIEEFGKEGNSTGEKIE
EWKIVDVLSKFIKPKNPSLVRESAMLIISNIAQFFSGKPPQEAYLLPFFNVALDCISDKE
NTVKRAAQHAIDSLLNCFPMEALTCFVLPTILDYLSSGAKWQAKMAALSVVDRIREDSAN
DLLELTFKDAVPVLTDVATDFKPELAKQGYKTLLDYVSILDNLDLSPRYKLIVDTLQDPS
KVPESVKSLSSVTFVAEVTEPSLSLLVPILNRSLNLSSSSQEQLRQTVIVVENLTRLVNN
RNEIESFIPLLLPGIQKVVDTASLPEVRELAEKALNVLKEDDEADKENKFSGRLTLEEGR
DFLLDHLKDIKADDSCFVKPYMNDETVIKYMSKILTVDSNVNDWKRLEDFLTAVFGGSDS
QREFVKQDFIHNLRALFYQEKERADEDEGIEIVNTDFSLAYGSRMLLNKTNLRLLKGHRY
GLCGRNGAGKSTLMRAIANGQLDGFPDKDTLRTCFVEHKLQGEEGDLDLVSFIALDEELQ
STSREEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDV
SNVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEA
KSYYTLTDSNAQMRFPPPGILTGVKSNTRAVAKMTDVTFSYPGAQKPSLSHVSCSLSLSS
RVACLGPNGAGKSTLIKLLTGELVPNEGKVEKHPNLRIGYIAQHALQHVNEHKEKTANQY
LQWRYQFGDDREVLLKESRKISEDEKEMMTKEIDIDDGRGKRAIEAIVGRQKLKKSFQYE
VKWKYWKPKYNSWVPKDVLVEHGFEKLVQKFDDHEASREGLGYRELIPSVITKHFEDVGL
DSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSG
GVVMISHNNEFVGALCPEQWIVENGKMVQKGSAQVDQSKFEDGGNADAVGLKASNLAKPS
VDDDDSPANIKVKQRKKRLTRNEKKLQAERRRLRYIEWLSSPKGTPKPVDTDDEED
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaagaagtttaaggatctaaactctttccttgacgaccaaccaaaggaccca
aatctagtcgcttctcccttcggtggttattttaaaaaccctgctgctgatgccggtagt
aataacgcttccaaaaaaagtagctaccaacaacagcgtaattggaaacaggggggcaac
taccaacaaggtggttaccaatcgtataacagtaattacaacaattacaacaactacaac
aactacaacaattataacaactacaataactataataaatacaatggccagggctatcaa
aaatctacttacaaacaatcggctgtgacgcccaaccaaagtggaactccaactccatct
gcttctactacatctttgacctctttgaatgaaaagctgtcgaacttagagttaacaccc
atctctcaatttttgtcaaagatacctgaatgtcaaagtatcactgattgcaaaaatcaa
atcaaactaatcattgaagaatttggcaaagaaggtaacagtacgggtgagaaaattgaa
gagtggaaaatcgtcgatgttctatctaaattcatcaaacctaagaatccatcattagtt
agagaatctgccatgctaataatttccaacattgctcaatttttcagtggaaagccacca
caggaagcatacttgctaccattcttcaatgtcgcacttgactgtatttcagataaagag
aatacagtcaaacgtgccgcgcaacatgccattgattctttgttgaattgctttccaatg
gaggctttaacctgttttgtactgcctacgattttggattacttatcatctggtgccaaa
tggcaagctaaaatggccgctctaagcgttgtagatagaataagagaagattcggcgaac
gatttattggaacttactttcaaagatgcagttccagttttaaccgatgtagcaactgat
ttcaaacctgaattggccaaacaaggttacaaaactttattggactacgtttctattttg
gataacttagatttgtctcctcgttataaattgatcgtggacaccctgcaagatccatct
aaggttcctgaatctgtaaaatcgttatccagtgttacatttgtcgctgaagttacggaa
ccttcactatctttgttagttcctattctaaacagatctttaaacctatcgtcatcatct
caagagcaattaagacaaaccgttattgtcgtggagaatttgacaagattggtgaataat
cgtaatgaaattgaaagcttcatccctctactactacccggtatccaaaaggttgttgat
actgcgtccttacctgaagttcgtgaattggctgaaaaggcccttaacgttctaaaagaa
gatgacgaagctgataaggaaaacaaattctcaggcagactgactttagaagaaggtagg
gatttcttacttgatcacctcaaggacattaaagctgatgattcctgttttgtcaagcct
tacatgaatgacgaaactgttatcaagtatatgagcaagattttgaccgtggattctaat
gtgaacgactggaaaagacttgaagattttttgaccgccgtttttggtggttcagattca
caaagagaatttgtcaaacaagactttatccataacttgagagctttattctaccaagaa
aaggaaagggcagatgaggacgaaggtattgagattgtcaacactgatttctccttagct
tatggttcaagaatgcttttgaacaaaacaaatcttcgtctcctaaagggtcatcgttac
ggtttgtgtggtagaaatggtgctggtaagtctactttaatgagagcaattgctaatggt
caattggatggttttcctgacaaggatacattacgcacctgtttcgtcgaacataaattg
caaggtgaagaaggtgatttagacttggtttccttcattgctttagatgaagaactgcaa
tctacttctcgtgaggaaattgcagccgctttagaatctgtcggttttgatgaagagaga
agagcacaaactgttggatctttatctggtggttggaaaatgaagttggaattggcaaga
gctatgttacaaaaagctgatattttattgctggatgaacctaccaatcatttagatgtt
tcgaacgttaaatggttagaagaatacttactggaacatactgatattacttcattgatt
gtttcgcatgactctggtttcttagatacagtctgtactgacatcatccattatgaaaac
aagaaattggcttactacaaaggtaacttggcagcatttgttgagcagaaacctgaagct
aaatcttactataccttaacagattctaatgctcaaatgcgtttcccacccccaggtatt
ttaacaggtgttaagtctaacactagagccgtcgctaaaatgactgatgtaactttctct
tatccaggtgcccaaaagccttccttaagccatgtctcctgttcattgtctctgtcttct
cgtgtggcttgtttaggtcctaacggtgctggtaaatccactttgatcaagctattaact
ggtgaattggttccaaatgaaggtaaagtggaaaaacatccaaatttacgtattggttat
attgctcagcatgcattgcaacacgtcaatgaacataaggaaaagacggcaaaccaatat
ttgcaatggcgttatcaattcggtgacgaccgtgaagtcttattgaaggaatccagaaaa
atatccgaagatgaaaaggaaatgatgacaaaggaaatcgacattgatgacggtagaggt
aagagagccattgaagctattgtaggtagacaaaagttgaaaaaatctttccaatatgag
gtcaaatggaaatactggaaaccaaaatacaactcctgggttccaaaagatgttttggtc
gagcatggctttgaaaaattggttcaaaaattcgacgatcacgaagcctccagagaaggg
ttgggttaccgtgaattaattccttcagttatcaccaaacattttgaagacgttggtctt
gattctgaaattgctaaccatactccattaggttctttatctggtggtcaattagttaaa
gtcgttattgccggtgctatgtggaacaaccctcatttacttgttttggatgaacctacc
aactatttggacagagactctcttggtgctttggccgttgctattcgtgactggagtggt
ggtgtcgttatgatttcgcataataacgaatttgttggtgctttatgtcctgaacaatgg
attgtggagaacggtaaaatggttcaaaagggctctgcacaagttgaccaatccaaattc
gaagatggtggtaatgctgatgccgttggtctaaaggcctccaacttggccaagccatct
gtagatgacgatgattctccagctaacatcaaggtcaagcaaagaaagaagagattgaca
agaaatgaaaagaagctgcaagccgaacgtcgtcgtctacgttacattgagtggttgtca
tcgccaaaaggtacaccaaaaccagttgatactgacgatgaagaagattga

DBGET integrated database retrieval system