KEGG   Saccharomyces cerevisiae (budding yeast): YPL247C
Entry
YPL247C           CDS       T00005                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11805  DDB1- and CUL4-associated factor 7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YPL247C
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     YPL247C
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 855829
NCBI-ProteinID: NP_015077
SGD: S000006168
UniProt: Q12523
Position
XVI:complement(82625..84196)
AA seq 523 aa
MDPFHNGNKRSSISFGSSQRQPYNKNNYLSGTNGPSSAAQDQGRGPSPFGMSGNTTNGGN
SKRNSGCDLSATYYASRSPMYSPLDFSPPVFSPNHSQLQQARGYAANIPVVSNLMNPSMA
SVCEYQSHYPLFGLDWSADDYVCLGSYKEDSRNKLQVLHSNDLLSWESVVDADVVYPVSK
IQWVPSQLYPRKLATCSDSLRIWSVSPEERQFQEQINLSLCKYNRQHPANPAAADDMKVI
GTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKST
QLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPY
DPNVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVL
YWDLNSSFMEINAAGSKSPSIHGTSLEDPDGDTEMTDGGAGSGLNEDPLSLNNNSKQVCK
TLETPNMMYANKTQEINNIAWRPQRGDWFGCVSGKKFQNVRVL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatccctttcacaatggcaataaaaggagctcaatatcgtttggctcatcgcagcgg
cagccatataacaagaacaattacttgagtggtactaatgggccttcctcggcggcacaa
gatcaaggtagaggcccatctccctttggaatgtctggcaacactaccaatggcggtaac
agcaaaaggaatagtggctgtgacctaagtgccacgtactatgcaagtcgatcgccgatg
tattcaccgttagatttctcgccaccagttttttcaccaaatcattctcagttacagcag
gcgaggggctatgctgcaaatattccggttgtaagcaatctgatgaacccttccatggcc
tccgtgtgcgaatatcaatcacactatccactctttgggctcgattggagcgccgacgac
tacgtctgcttgggttcgtacaaagaggacagcagaaataagttgcaggttctgcactct
aatgatctactgagctgggaaagcgtagtggacgcagatgtggtttatcctgtgagcaaa
atccaatgggtcccctctcaattgtatccaaggaaactcgcgacgtgttctgactcctta
cggatttggagcgttagccctgaggaaagacagttccaagaacaaataaatctatctctg
tgtaaatacaatagacagcaccccgccaatcccgcggccgcagatgacatgaaggtcata
ggcactttcccaccaataacatcatttgactggaacacggtcgatactaacttgataatc
tcaagttccatcgacaccacatgcattgtatgggatctgcaaagcagtcactacgttaag
acccaattgatcgctcacgacagcgaagtttttgatgtaaggtttttgacaaaatcgacc
caattatttgctagttgtggtggggacggtagtgtacgagtatttgatttaagatcgctt
gcgcacagtacaattatttacgagcctccctcttcctcagtgtctggagccactgcgggt
actataacaccgtcgtcgaaaggttcggacgccttattgaggctggagccatcaccgtat
gacccaaatgtgttggccacttttgcagctgactcgaacaaaatcattattctagatatg
aggaacccagaatcccctatactaaacttacaaggccacggttcttcggtaaacgggatt
aaatggcatcccacaaagcgcaatgttttgctctcgtgcggagatgactgccaggtgctc
tattgggacttgaacagctcctttatggaaattaacgctgcaggtagcaaatcccccagt
attcatggaacttccttggaggaccctgacggcgacacagagatgacagacggtggcgca
ggatccggtttaaacgaggatcccttaagtttaaacaacaacagcaagcaggtgtgcaag
acactagagactcctaacatgatgtatgccaataaaacacaagagataaacaacattgca
tggaggccccagaggggcgattggtttgggtgcgtgagcggcaagaagtttcaaaacgtc
cgcgtcctttga

DBGET integrated database retrieval system