KEGG   Saccharomyces cerevisiae (budding yeast): YPL249CHelp
Entry
YPL249C           CDS       T00005                                 

Gene name
GYP5
Definition
(RefSeq) Gyp5p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RabGAP-TBC GIT_CC
Motif
Other DBs
NCBI-GeneID: 855827
NCBI-ProteinID: NP_015075
SGD: S000006170
UniProt: Q12344
Position
XVI:complement(76669..79353)
Genome map
AA seq 894 aa AA seqDB search
MSSDKSIEKNTDTIASEVHEGDNHSNNLGSMEEEIKSTPSDQYEEIAIIPTEPLHSDKEL
NDKQQSLGHEAPTNVSREEPIGISGDEDTQITEQNVNEQRQETREPSSEIDLNEPLDVEK
DVTTDVQAPNGLNIEKEYDAVKENEKVYADTKEVVSSPENREVTGKNSGGEKSSSSKFLD
DESGTTTAANANDISISSEVTPERSSENDNNQIHITNEVAAGINLNENKEQKAAIEDGPV
TAENLSSETARKVPPIPTQIINEKGDNSSENEVSAIPTTSSPPLPPRQNVATSTSPKLPP
RGKQREQPPKTKNAVPPPLEEEMKSEKFRKNFEETKRNSYHHVPLTGSKTAQLESTAEIN
LIASRYRKTSHHLNKEGEETRESLQEGQSFLKSTFTSFLENLSEYNEVENVNEEDREMFK
IDWSFWTQVVNDYATVASNEPENLEAHVTNGIPPQIRGIIWQLMANSKSREMEDIYETLL
DTECLHEATIRRDLRRTKFVAEDKMESLYKVIKVYSVYDPDVGYTQGMGFIAAPLLINCE
NEAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSPSLYNRLIREGISSTM
YATQWFLTFFAYKFPLEFVLRIFDIVFVEGIEVLLKFAVNLMLKNEETLVKLRFDELLDF
LKDELFNYYLMGNQDDASVVQMGLSNGNSFKGNDDGTFSYNVDLFVHDAMTGVYITPLTL
RRYRGEYVEIHEKEQKKEDHYESLRIQNHQLQREAQKLEHDYSILNKENISAANELIQNR
LNMEMLLDEKNDLINTITDIKSQIEEEIRKQNLPNPDASLPKADLREDLERTISRNNEVM
RENGQLEERITELQAEIDELININKEQVSTASLLERDSKAKGRKGWTGFKKVFK
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagacaaatctattgagaaaaatacagatacgatcgcctctgaagttcacgaa
ggtgataatcattcgaataatttgggttcaatggaggaagagataaaatcaacgccatca
gaccaatatgaagagatagctataattccaactgagcccctccattcggacaaagaacta
aatgacaagcaacaaagtttaggccatgaagcacccacaaatgtatcaagagaagaacct
attgggatctctggtgatgaagacacccaaatcactgaacaaaacgttaatgaacaaagg
caagaaacgagagaacctagttctgaaattgatttaaatgagccattggatgttgaaaaa
gatgtgacaacggatgtgcaagccccaaatgggctgaatattgaaaaagaatatgatgca
gtcaaagagaatgagaaggtttacgctgatacgaaagaggttgttagtagtccagaaaat
agggaagtaactggaaaaaattctggaggtgagaaatcatcctcgagtaaatttctcgat
gacgaatctggtactacgacagctgcaaatgcgaacgacatttctataagtagtgaagta
accccagaaaggtcgtcagaaaatgataataaccagattcatattaccaatgaggtagcc
gcaggaataaacttgaatgaaaacaaggaacaaaaagctgctatagaagatgggcccgta
acagcagagaatctttcctcagaaactgctaggaaagtaccacctatacccacacaaatc
ataaatgaaaaaggtgataactcaagcgagaacgaggtttccgcaattcccactacatct
tcgccaccattaccacctagacaaaatgttgcgacatcaacgtcaccaaaattacctcca
aggggcaaacaaagggaacaaccaccgaagacgaagaatgctgttccaccgccactagag
gaagaaatgaagtcagagaagttccgtaaaaacttcgaagaaactaaaagaaatagttat
catcatgttcctctcactggttccaaaactgcgcaattagagtccactgcagaaattaat
ttgatcgctagtcgttaccgcaagaccagtcaccatttgaataaagagggggaagaaact
agagagtcgttgcaggaaggtcaaagctttttaaaatcgacatttacgtcatttctggag
aacttgtccgagtataacgaagtggagaatgttaatgaagaagatagagaaatgtttaaa
attgattggtccttctggactcaagtagttaatgattatgctacagtggcaagcaacgaa
ccagaaaatttagaagcccatgttaccaatgggataccaccacaaattcgaggtatcatt
tggcagctgatggcgaattccaaatcaagagaaatggaagatatatatgaaactctattg
gataccgaatgtcttcatgaagcaacaatacgtagagatttaaggagaacgaagtttgtg
gccgaggacaaaatggagtcactatacaaggtaataaaggtgtattctgtttatgatcca
gatgttgggtacacgcaaggcatggggttcattgcagcgccgctattaataaactgtgaa
aacgaggccgaatcttttggactactcgttggattaatgaagaattatggattaagagag
cttttcttaccaggaatgcctgggctgatgttaatgctttatcaatttgatagattatta
gaggagcattcaccttctttgtacaatcgcttgatccgtgagggaattagctccacaatg
tacgctacacaatggtttttgacatttttcgcatacaagtttccgttagagtttgtgtta
agaatttttgatattgtattcgtagagggtattgaagtgcttttgaagtttgctgtaaat
ttaatgttaaagaatgaagaaactttagtaaaattgagattcgatgaactattggatttt
ttaaaggacgaactcttcaattactatttaatgggaaaccaggatgacgcttctgtagtg
caaatgggattgtcaaatgggaactcatttaagggcaatgatgacggcactttttcctac
aatgtcgatcttttcgttcatgatgcaatgacaggtgtatatatcacaccattaacatta
agaagatacaggggagagtacgtagaaatccatgaaaaagagcaaaaaaaagaggaccac
tacgaatcactaagaattcaaaaccaccaactacaaagagaggcgcagaagctagaacac
gactattcaattttgaacaaagagaatatcagcgccgctaacgagctgattcagaacaga
ttgaatatggagatgctgttggatgaaaaaaacgacctgataaatacaatcactgatatc
aaaagccaaattgaggaagagattcgcaagcaaaatttaccgaacccggacgcgtcacta
ccaaaggcagatctgagagaagacttggaaaggaccatatccaggaacaatgaggtgatg
agggagaacggccaattagaggaaagaatcactgaactgcaagcggaaatcgatgagttg
attaacatcaataaggagcaagtgtccacggcatcgttattggaacgagattctaaggct
aaagggaggaaaggctggactggttttaaaaaagtttttaaatag

DBGET integrated database retrieval system