KEGG   Saccharomyces cerevisiae (budding yeast): YPL252C
Entry
YPL252C           CDS       T00005                                 

Gene name
YAH1
Definition
(RefSeq) adrenodoxin
  KO
K22071  ferredoxin-2, mitochondrial
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YPL252C (YAH1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    YPL252C (YAH1)
SSDB
Motif
Pfam: Fer2
Other DBs
NCBI-GeneID: 855824
NCBI-ProteinID: NP_015071
SGD: S000006173
UniProt: Q12184
Structure
PDB: 
2MJD 2MJE

Position
XVI:complement(73363..73881)
AA seq 172 aa
MLKIVTRAGHTARISNIAAHLLRTSPSLLTRTTTTTRFLPFSTSSFLNHGHLKKPKPGEE
LKITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALP
EPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRNVNNNDFS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgctgaaaattgttactcgggctggacacacagctagaatatcgaacatcgcagcacat
cttttacgcacctctccatctctgctcacacgcaccaccacaaccacaagatttctgccc
ttctctacgtcttcgttcttaaaccatggccatttgaaaaaaccgaaaccaggcgaagaa
ctgaagataacttttattctgaaggatggctcccagaagacgtacgaagtctgtgagggc
gaaaccatcctggacatcgctcaaggtcacaacctggacatggagggcgcatgcggcggt
tcttgtgcctgctccacctgtcacgtcatcgttgatccagactactacgatgccctgccg
gaacctgaagatgatgaaaacgatatgctcgatcttgcttacgggctaacagagacaagc
aggcttgggtgccagattaagatgtcaaaagatatcgatgggattagagtcgctctgccc
cagatgacaagaaacgttaataacaacgattttagttaa

DBGET integrated database retrieval system