KEGG   Saccharomyces cerevisiae (budding yeast): YPL255WHelp
Entry
YPL255W           CDS       T00005                                 

Gene name
BBP1
Definition
(RefSeq) Bbp1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BBP1_C BBP1_N ArsR Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 855820
NCBI-ProteinID: NP_015068
SGD: S000006176
UniProt: Q12365
Position
XVI:67725..68882
Genome map
AA seq 385 aa AA seqDB search
MNQEDNTGGGGIFGLFKWTKDALFGTDISPSMKYKDQEERRDRSRYAQDDTNFSMKFGND
SNRRSTNLSRSNSWSGLDSTLHRKYELLPEYNENGFNSIVNGDHHSKERIRSLRSPAPIV
PREPLRNEPTDTFGHRLHTKRRTINELSNSQIPFIPPQEDDPLLSKLFNKDGVNEVRRSP
YKLSVKDIPGKFPSPLTKRDEIDNYYVRDEDACHKNREYKKAYFDLFAQMDLNSRDLEDL
CEDVREQREQFHRNEQTYKQAYEEMRAELVNELKKSKTLFENYYSLGQKYKSLKKVLDQT
ISHEAELATSRERLYQEEDLKNFEIQTLKQRLSDLELKYTNLQIEKDMQRDNYESEIHDL
LLQLSLRNNERKDTSAGSNIFSTGQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggaagacaacacgggcggagggggcatttttggtcttttcaaatggactaag
gatgcgctgtttggtacggacatatcaccttcaatgaaatataaagatcaggaagaacga
agagaccgatctaggtatgcccaagacgacacaaatttttctatgaagtttggaaatgac
tccaacaggaggagtacaaacttatcgaggtcaaattcgtggtctggtctggattcaacg
ctccataggaagtacgagttactcccagagtacaacgagaacggctttaactcaattgtt
aacggtgaccaccacagcaaagagagaatacgatctttacgaagtcctgctccgatagta
ccgagagaaccacttcgtaacgaacctacggatacatttggtcacagactacacacaaaa
aggagaactataaatgagctttccaattcgcagataccctttataccacctcaggaagac
gaccctttgctctcgaaattatttaacaaggatggagttaatgaggttagaagatcgccc
tataagttatcggttaaagatataccaggcaaatttccatctcccttaacaaaacgtgat
gaaatagacaattactatgtccgggacgaagatgcttgccacaagaatagagagtataaa
aaggcatattttgatctttttgcacaaatggacttgaacagtagagacctggaagatttg
tgtgaggatgttagagagcagcgtgagcaattccacaggaatgagcaaacttataagcaa
gcatacgaggaaatgagagcagaactggtcaacgagttgaagaaatctaagacactcttt
gaaaattattattcattaggtcagaagtacaagagtttgaaaaaggtccttgatcaaacg
atcagtcatgaggctgaactggccacttctagggaacggctgtatcaggaggaggatttg
aaaaactttgaaatacaaacattgaagcaaagactatccgatttagagctgaaatatacc
aatttgcaaatagaaaaggacatgcagcgggacaattatgaatccgaaatacatgattta
ttattacagcttagccttcgtaataacgagagaaaagatacttctgctggttcgaatatt
ttttcaacaggacaatag

DBGET integrated database retrieval system