KEGG   Saccharomyces cerevisiae (budding yeast): YPL256CHelp
Entry
YPL256C           CDS       T00005                                 

Gene name
CLN2
Definition
(RefSeq) cyclin CLN2
  KO
K06650  G1/S-specific cyclin CLN2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Module
sce_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YPL256C (CLN2)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPL256C (CLN2)
   04113 Meiosis - yeast
    YPL256C (CLN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 855819
NCBI-ProteinID: NP_015067
SGD: S000006177
UniProt: P20438
Position
XVI:complement(64977..66614)
Genome map
AA seq 545 aa AA seqDB search
MASAEPRPRMGLVINAKPDYYPIELSNAELLSHFEMLQEYHQEISTNVIAQSCKFKPNPK
LIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYDRYCSKRIVLRDQAKLVV
ATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYCGDGQVFDESMFL
QMERHILDTLNWNIYEPMINDYVLNVDENCLMQYELYENQVTYDKQCSEKRQSQLSQDSD
ATVDERPYQNEEEEEEDLKLKIKLINLKKFLIDVSAWQYDLLRYELFEVSHGIFSIINQF
TNQDHGPFLMTPMTSESKNGEILSTLMNGIVSIPNSLMEVYKTVNGVLPFINQVKEYHLD
LQRKLQIASNLNISRKLTISTPSCSFENSNSTSIPSPASSSQSHTPMRNMSSLSDNSVFS
RNMEQSSPITPSMYQFGQQQSNSICGSTVSVNSLVNTNNKQRIYEQITGPNSNNATNDYI
DLLNLNESNKENQNPATAHYLNGGPPKTSFINHGMFPSPTGTINSGKSSSASSLISFGMG
NTQVI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgctgaaccaagaccccgtatgggactcgtcatcaatgctaaaccggactac
tatccgattgagctatctaatgcagaattactttctcacttcgaaatgctgcaagaatac
caccaagaaatctccaccaatgttattgctcaatcatgtaagttcaaacctaatccaaaa
ctaatagaccagcagcctgaaatgaaccccgtggaaacaaggtccaacattatcactttt
ttgttcgagctgtctgtggtcactcgagtgacaaatggtattttttttcattcagttaga
ttatatgaccgctattgttccaagagaatcgtgttacgggaccaagccaaattggttgtc
gctacttgtctctggttggctgctaaaacttggggcggttgtaatcacatcatcaataat
gtagtcatccctactggcggaagattttatggtcccaacccaagggcacgtatacctcga
ctctctgaactagttcattactgtggtgatggtcaggtctttgatgaatcaatgttttta
caaatggaaagacatatactagacactttaaattggaacatttatgaaccaatgatcaat
gattacgttttaaatgttgatgaaaattgtttgatgcaatacgaactttatgaaaatcaa
gttacttatgacaaacaatgctctgaaaaacgtcagtctcaattatcccaggatagtgat
gccactgtagacgagaggccctaccaaaacgaagaagaagaagaagaagacttaaaacta
aagatcaagttgattaatttgaaaaaattcttgattgatgtatccgcgtggcagtacgac
ttacttagatatgaacttttcgaagtatcgcacggcatattctccattatcaatcaattc
accaatcaagaccacggtccttttttaatgactccaatgacatcagaaagcaaaaatggt
gaaattttgagtaccttaatgaacggcattgtttccattcctaactccttgatggaagtg
tataaaacggtcaatggtgttctacccttcattaatcaagtgaaagaatatcacttggat
ctacaaagaaaactgcaaattgcatccaacttgaacatttcgagaaagcttaccatatca
accccatcatgctctttcgaaaattcaaatagcacatccattccttcgcccgcttcctca
tctcaaagccacactccaatgagaaacatgagctcactctctgataacagcgttttcagc
cggaatatggaacaatcatcaccaatcactccaagtatgtaccaatttggtcagcagcag
tcaaacagtatatgtggtagcaccgttagtgtgaatagtctggtgaatacaaataacaaa
caaaggatctacgaacaaatcacgggtcctaacagcaataacgcaaccaatgattatatt
gatttgctaaacctaaatgagtctaacaaggaaaaccaaaatcccgcaacggcgcattac
ctcaatgggggcccacccaagacaagcttcattaaccatggaatgttcccctcgccaact
gggaccataaatagcggtaaatctagcagtgcctcatctttaatttcttttggtatgggc
aatacccaagtaatatag

DBGET integrated database retrieval system