KEGG   Saccharomyces cerevisiae (budding yeast): YPL259CHelp
Entry
YPL259C           CDS       T00005                                 

Gene name
APM1, YAP54
Definition
(RefSeq) Apm1p
  KO
K12393  AP-1 complex subunit mu
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPL259C (APM1)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    YPL259C (APM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Motif
Other DBs
NCBI-GeneID: 855869
NCBI-ProteinID: NP_015064
SGD: S000006180
UniProt: Q00776
Position
XVI:complement(51244..52671)
Genome map
AA seq 475 aa AA seqDB search
MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI
QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL
DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA
SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK
FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD
TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE
ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgcagtgtatttttgcgatcataatgggaaaccactcctatcaagaaggtat
agagatgatattccgctttctgcaattgacaaattccctatattactctcggatttagag
gaacaatcaaatctgattcctccatgtttgaaccacaatggtctggaatatctatttata
cagcataacgatctatacgtggtggcaattgtgacttctcttagtgccaatgcggctgcc
atttttacttttttgcacaaattagtggaggtattaagtgactacttaaaaaccgttgaa
gaagaatctattagagataattttgttataatatatgaattactggacgaagtgatggat
tatggtataccacagatcacagaaactaagatgctgaaacagtacataacacaaaaatcc
ttcaaactagttaaatccgccaagaagaagaggaatgctactagaccacccgtcgcacta
acaaattcagtcagttggaggccagaaggcatcactcacaagaaaaatgaagcctttctg
gatatcgtcgaatctattaatatgctcatgactcaaaaaggtcaagttttgagatcagaa
attatcggcgatgttaaggttaactcaaaattgtctggtatgcctgatctgaaattaggt
attaatgataaaggcattttctccaaatatttggatgatgatacaaatatcccatcagcg
agcgcgacaacatccgataataacacagaaactgataaaaaaccatcaataacatcatca
tcggccacaaacaagaagaaagttaatattgaattggaagatttgaaatttcatcaatgt
gtccgattaagcaaattcgagaatgaaaaaattataacgtttatacctcctgatggaaag
ttcgatttaatgaactacagactatctactacgataaaaccgttaatttggtgtgatgta
aacgttcaagttcattcgaattctagaattgaaattcactgtaaggccaaggcccaaatt
aaaagaaaatctactgcaactaatgtagagatattgataccggtcccggacgacgcggat
acaccgacttttaaatattcacacgggtctctaaagtatgtccctgaaaaaagtgcaatc
ttatggaaaataagaagttttcccggtggtaaagagtactcaatgtctgccgaattggga
ctgccttcaatatcaaataacgaggatggcaatagaacaatgccaaaaagtaacgcggaa
atcttgaagggacctgtccaaatcaaatttcaaataccctactttactacttcaggtatt
caagtacgttatcttaaaattaacgaacccaaattgcagtataagagttacccatgggta
agatatatcacgcaaagtggtgatgattatacaataaggctgacgtaa

DBGET integrated database retrieval system