KEGG   Saccharomyces cerevisiae (budding yeast): YPL260WHelp
Entry
YPL260W           CDS       T00005                                 

Gene name
CUB1
Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2408 TnpV MLD Sec20
Motif
Other DBs
NCBI-GeneID: 855867
NCBI-ProteinID: NP_015063
SGD: S000006181
UniProt: Q08977
Position
XVI:49303..50958
Genome map
AA seq 551 aa AA seqDB search
MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER
KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT
MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK
FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE
NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF
YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNSTSSDGSDDDDNGESGIDSNSN
DSEPESEYQQE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatccgctggacaacaacaccctcaaattgttcctaaggaagaggaatccata
ttaaactacctccttgaagtgagatcctccttggctaaactcaagcaaaataggacccag
tatttgaactctaaggatgtccaaactacttaccaacacgtcttgaccaaagtcagagag
ttggacgatattaggaagaatagtcatgagacgcccgctaagagcgccgccaccctgatt
catagtactgaattgcataatagagttgactccgtactggatgatgtctttcaattgctc
tcgttgtgttttttaactgttgggctaaaaaattctgcacctgcgacttatgcatcgtta
tctactgtggagagtcttttggaacatttaaatgaatcaaacgtcttcacccatcacgat
ttgagtcctattaaggaaaggctggaagaaatcagcaagattgtcgaacaaaaaaactct
agtcctgcgtacgatgaggatggaaatgatgaccgattaagggaaatcgacaacgaaagg
aaaaagaataaaattgaggaagacctattactacgtgctaaattaaagcattgcaaggac
gaatatgatatattggaaggcaaattggaggaaattgatccgtctttgtctactgtaatg
gaaaagttattccgaattagaagaggtttattgtcattagttgcatctgctaaaaaaaca
atgtctaaatctgatattaataccaactctttattgcaggaacaaaatgatttgcaaacg
aacaatgaaagcttaacggatgacaaacatttagtatctcaagagtatgtccatgagaaa
ttatcagttttgaagaacgaattaagtgaattagaatctaatcgtgacgattctggtaaa
ttcaagtccttggagtctcatcaggtggcagaaaaaggccaaagtgtccttaatggttta
ttggatgattgccatgatttagttaacgatttatcacaccaaaaaaatggcgggttgact
ttagatccatatttacagccaatatatgaacagctgattgatataaagactaccttagaa
aatttaatgatcacaagaagatggactttgagagaaaccgatttattttcttaccaaaaa
aaattgaacgaaattgataacaaaagaatcaatggtaagtttccaacaaaatctcaggac
tcaaaggggcaatcaatacttttatacctgttgcgtagatgttatgccataatttataaa
ctgttggaaagttcagagcccgtatctgaagcgttgcagccaattcacaatcaactatct
acagttcgtcgttgcctattagaattgaaaagaatgggaggtgtgaataatgaaagagag
ttatacccttatcaaatgaaattggcttcattggacaacctgagaactgaaggtatattc
tatgactctgatggcaatatacctgaaggccaaggtatattgaatgctttattagcagaa
tgttttgatatcttgcatgaattaaaagtggaagccgaggaaaaagcacagaactctact
tcaagtgatggttctgacgacgatgacaacggagaatcaggcatagactcgaactcaaac
gacagcgagcctgaatctgaatatcaacaggaatag

DBGET integrated database retrieval system