KEGG   Saccharomyces cerevisiae (budding yeast): YPL262WHelp
Entry
YPL262W           CDS       T00005                                 

Gene name
FUM1
Definition
(RefSeq) fumarase FUM1
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00620  Pyruvate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPL262W (FUM1)
   00620 Pyruvate metabolism
    YPL262W (FUM1)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     YPL262W (FUM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C ADH_N
Motif
Other DBs
NCBI-GeneID: 855866
NCBI-ProteinID: NP_015061
SGD: S000006183
UniProt: P08417
Structure
PDB: 

Position
XVI:47336..48802
Genome map
AA seq 488 aa AA seqDB search
MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG
GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF
QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ
IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV
ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ
VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE
PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
PEHMLGPK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatttaccaattgtagttgcaagactttcgtaaaatcgtcatataagcttaat
ataagaagaatgaactcctcgttcagaactgaaaccgatgcatttggtgagatacacgtg
cctgctgataagtactggggtgcccaaactcaaagatcctttcaaaacttcaagattggt
ggcgctcgtgaaagaatgccattgcctttggtgcatgcatttggtgttttgaagaaatct
gccgcgattgtgaatgagtctctggggggattggatcccaagatctccaaggctattcaa
caggccgctgacgaagtggcttctggtaagctagacgaccactttccattggttgttttc
caaacgggttccggtacccagtctaacatgaatgctaatgaagttatttccaatcgtgcc
attgagatcctaggaggcaagattggatctaaacaagtccatccaaacaatcattgcaac
caatctcaatcatccaatgatactttccccactgtcatgcatatcgctgccagtttgcaa
attcaaaacgagttgatacctgagttgaccaatttaaagaacgcccttgaagccaaatcc
aaggaatttgaccatattgtgaagatcggtagaacacacttgcaagatgccacgcctttg
acactaggtcaagagttttccggttacgtgcaacaagttgagaacggtatccaaagagtg
gcacattctttgaaaacattgagtttcctggcacaaggtggtactgccgttggtacaggg
ttgaacaccaagcccggattcgatgtcaagatagccgagcaaatttccaaagaaactgga
ctaaagtttcaaaccgcccctaataagttcgaggctttggctgctcacgacgccattgtc
gaatgtagcggtgctctaaacacccttgcttgttctcttttcaaaatagcgcaagatata
agatacttagggtccgggccacgttgcggctaccatgaactaatgctgccagagaatgaa
ccaggttcctcaatcatgcctggtaaagttaacccaacccaaaacgaggcattgactcaa
gtgtgtgtgcaagtcatgggtaacaatgcagctatcacgtttgccggctctcaaggtcaa
ttcgagttaaatgtcttcaagccagtcatgatcgccaatctattgaattcgatcaggtta
attactgatgccgcatattcatttagagtgcactgtgttgaaggtatcaaagccaatgag
cctcgtattcatgagttgttgactaaatctttaatgttagtcaccgctttgaaccctaag
atcggttatgatgccgcttccaaggtcgccaagaatgctcataagaagggcattaccttg
aaggaaagtgcattggaattgggtgtattgactgaaaaggaatttgatgaatgggttgtt
cctgaacacatgctaggtcctaaataa

DBGET integrated database retrieval system