KEGG   Saccharomyces cerevisiae (budding yeast): YPL263CHelp
Entry
YPL263C           CDS       T00005                                 

Gene name
KEL3
Definition
(RefSeq) Kel3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kelch_4 Kelch_3 DUF4110 Kelch_6 Kelch_1 Kelch_5 Kelch_2 BUD22
Motif
Other DBs
NCBI-GeneID: 855865
NCBI-ProteinID: NP_015060
SGD: S000006184
UniProt: Q08979
Position
XVI:complement(44551..46506)
Genome map
AA seq 651 aa AA seqDB search
MAKKNKKDKEAKKARAELKNQKNQKKQEKKFQKNKNKSLNGEEDDESDQDLDEILSSFSK
KQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYS
IKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER
KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT
KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKK
WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLEL
NKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDNDDNST
TGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDY
PINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDEDDGEEEQDA
GPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRN
LKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDTTTKPSKRR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaataagaaggataaagaggccaaaaaggcacgtgctgaactgaagaat
cagaaaaaccaaaaaaagcaggagaaaaagtttcagaagaacaagaataagtctttaaac
ggcgaagaagatgatgaaagtgatcaagatctcgatgaaattctctctagctttagcaaa
aagcaaattgaattagagcatgtagacatcacttctgtggaaaaaccctcttgtcgtact
catccgttgatgtttgcaaatccgcaacacaataaacatgaattgttcattttcggtggt
gaatttacagatccagaaaccaaactaacacatttctataatgatttgtattcatactcc
ataaagaacaactcttggaaaaaatacgtttcgcaaaatgcacctttgcccagatccagt
gccgctgtcgctgtgcatccttccggaatagcactgttacacggtggtgaattttcgtcc
ccaaaacaatctaaattctaccactattctgatacatggctgtttgactgcgttgaaagg
aaattcactaagttggagtttggcggtagagactcttcacccagcgccagatcaggtcat
agaattattgcttggaaaaactatttcatattatttggtggatttagagatttggggaat
ggtcaaacttcttacctaaatgatttgtggtgttttgatatctcaacctacaaatggacc
aaattggagacaaacagcaaacctgacgctagatcgggtcattgtttcattcctacagat
aattctgccatattaatgggtggttactgtaaaatcattgccaaaaataataaaaattta
atgaagggaaaaatcttgaatgatgcatggaaactgaacttaacgcctgatccaaagaag
tggcagtgggaaaaattaaagaatttcaagaaccagccctcaccaagagtcgggtattcg
ttcaatctatggaagcaaaacaagtccgttgcttttggtggtgtctacgatttacaagag
acagaggaatccttagagtccgttttctataacgacctatatatgttccacctagagttg
aacaaatggtctaaacttagaattaaacctcagcgtcaaacgaatagtaaaaattcaccc
gccacaagtaaaagaaaatctaataaagatcaagaaaaggaactgcaggatttactaaat
tccattctggccaagtctaatctaaatgacgacgacgatgacaatgatgacaacagcaca
acgggtcctaactctatcgatgacgacgaagataacgaagatgacagtgatttggacaac
caagaagatattaccatctcaaatcaattacctcacccaagatttaacgcagcaacttgt
gtagtgggcgactcgttgttcatttacagtggtgtctgggaactgggcgaaaaagattat
cctataaactcattttatagtatagatttgaacaagttggatggtgtcaaggtttactgg
gaagacctatctgccatcgaagaagcaaagagactaggtgatagagattcggacgaagat
gagtttgaatacgaggacgatgaggaggatgaggacgacggcgaagaggaacaagatgca
ggaccccttgaaggtgatgaagatgaggaaagcgagagcgacgatgacaaacaagcgcag
atggagattccagacgaaaggtcttggctaccacacccaaaaccgttcgaaactttaaga
gcattctacttaagggaaggtgcaaatttcttaacctggtctatttctaacaacagaaac
cttaagggtaaacagttaaagacgaagtcatttgagttatgtgaagaccgttggtgggaa
agaagagatcaggtgacccttgaggaagagcgtctggaggatacaggcggaatcattgaa
agagatacgactactaaaccttccaaaagaaggtaa

DBGET integrated database retrieval system