KEGG   Saccharomyces cerevisiae (budding yeast): YPL265WHelp
Entry
YPL265W           CDS       T00005                                 

Gene name
DIP5
Definition
(RefSeq) Dip5p
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPL265W (DIP5)
Transporters [BR:sce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YPL265W (DIP5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 855863
NCBI-ProteinID: NP_015058
SGD: S000006186
UniProt: P53388
Position
XVI:41043..42869
Genome map
AA seq 608 aa AA seqDB search
MKMPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVSSRSSTS
TSPSARDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAM
LIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPN
QLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGL
ILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI
ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA
AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT
SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA
CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV
YIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY
EKFLGNIF
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcctctaaagaagatgtttaccagcacgtctcctcgtaactcttcttctctt
gacagtgatcatgacgcttactattcgaaacaaaatcctgacaatttccctgtaaaggag
caagaaatctataacattgacctggaagaaaacaatgtgtcctctcgttcatccacctct
acatcaccttcagcaagggacgactctttcgcagttccagatggtaaagacgaaaacacg
cggttgaggaaagatttaaaggcaagacatatttctatgatcgccattggtggttcatta
ggtacaggtctgcttataggtacaggtaccgccttattgacgggtggtccggttgcgatg
ttaattgcatatgcctttgtcggccttttagtcttttacaccatggcctgtcttggtgaa
atggcttcttacattccattggatggttttacaagttatgcctcacgttacgtggatcct
gcattaggttttgctattggttatacttaccttttcaaatatttcatcttacctcccaac
caacttactgctgctgctttggtcattcaatattggatcagcagagaccgtgttaaccct
ggtgtgtggattactatattcttggttgttattgtcgctatcaatgtcgtcggtgtaaaa
ttctttggtgaatttgaattttggttgtccagtttcaaagtcatggtaatgttgggtcta
atcctgttactatttattattatgcttggtggaggtcctaaccatgaccgcctagggttt
agatactggcgtgatcctggtgcgttcaaagaatattcgacggctatcactggtggtaaa
ggtaaatttgtttcgttcgttgctgttttcgtttacagtcttttcagttacacgggtatt
gaattgacaggtatcgtttgttctgaagctgagaatccaagaaaaagtgttccaaaggca
attaaattgacagtttaccgtatcattgttttttacctatgcaccgttttccttttgggt
atgtgcgttgcatacaatgaccctcgtttactttccacaaaaggtaagagtatgtctgct
gcggcatctccattcgtggttgccattcaaaactcaggtattgaagtcttacctcatatc
ttcaatgcttgtgtcttggttttcgttttcagtgcttgtaactcagatttgtacgtttct
tccagaaatttatatgcgttggcaattgatggtaaagcgccaaagatcttcgctaagaca
agtagatggggtgttccttacaatgctttaatactctccgtgctgttttgtggcttggcg
tacatgaatgtgtcttcaggatcagcaaagattttcaactactttgttaacgttgtttct
atgttcggaatcttgagttggatcaccattttaattgtttacatctacttcgataaagcc
tgccgtgctcaagggattgacaaatcaaaatttgcttatgtcgctcctggccaacgttat
ggtgcttattttgctttattcttctgcattttgattgctttaatcaaaaacttcactgtt
ttcctaggtcataaatttgattataaaacattcatcaccgggtatattggcctgcctgtc
tatatcatttcttgggctggttacaaattgatatacaaaaccaaagtgataaagtctacc
gacgtggatttgtacacatttaaggaaatatacgatagagaagaagaagagggaagaatg
aaggaccaagaaaaggaagagcgtttaaaaagtaacggtaaaaatatggagtggttctat
gaaaaatttttgggtaatatcttctag

DBGET integrated database retrieval system