KEGG   Saccharomyces cerevisiae (budding yeast): YPL268WHelp
Entry
YPL268W           CDS       T00005                                 

Gene name
PLC1
Definition
(RefSeq) phosphatidylinositol phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00562  Inositol phosphate metabolism
sce01100  Metabolic pathways
sce04070  Phosphatidylinositol signaling system
sce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YPL268W (PLC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    YPL268W (PLC1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    YPL268W (PLC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPL268W (PLC1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     YPL268W (PLC1)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    YPL268W (PLC1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    YPL268W (PLC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_1 C2 EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 855860
NCBI-ProteinID: NP_015055
SGD: S000006189
UniProt: P32383
Position
XVI:35236..37845
Genome map
AA seq 869 aa AA seqDB search
MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTV
RRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTR
RRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWI
AIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQIT
VSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKI
LKNRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPTQLTMG
QDGFTKFLKEQPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQG
CRCVEIDIWDGENGPVVCHGFLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQ
KLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFS
SSYESANEQELRMKDDSTNSSSATNSSSMQRIKRIGLKKHADIINDVSNISGIHGIKFRN
FSLPESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIP
FWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIP
LIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDK
GTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVISEETQIASVCLKLNYL
RMGYRHIPLFNMEGEQYIFCTLFIHTQIL
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagtgctatagatgaccaaaggtttaatcttacaaaggagttacaacgacac
tcatgcagagatcaagggaaaataacacaaaaggatgatgctttagattttataagttac
agttcttttcaatcctcttttaatactgaccaaaaaagcgcgaacaatggaagtactgtg
agaagaagcataaggtcgatttttagaagagcagccgaattgcctagagtccatatgggg
cctcttacttattcacatgggataaatgagcttgttaacaagaaattaagaaaagactgt
gatctcagcacgctatgtcgcgtattgcaaagaggaatcaggatgattaggatgacaaga
agaagaaggaagttctatgaatttaaattaatcaataacaacgggcaaataatatggaaa
gatggttcgaagtatctggaattagactccgttaaagacatcagaatcggtgatacggcg
agtacttatcaagaggaagtagatccgaaaagattgagatcggacagtaaactttggatt
gctattatttataaggtttccaacaaattgaaagcgttacacgtagttgctttgaatgaa
ttggactttaacacattcttaagctgcatttgcggtttagtgaagttaaggagggaatta
atggaaagcatacttttgcctgataattcgcaattcgctaggatacattggcaaattact
gtttctgaaaaagaggaagatgagaaaaaggacacattgagctttgcagatgtgaagaaa
ctatgtgataaatttcatatttatgtgtcaactggtcaattgttagagtttttccaatta
gcagacatcaatcataacggactattaaattattttgaatttgaaaagttcattaaaatc
ttaaagaataggaaagaggtaaatatgatttggtctaaatttacaaaacctccacactcc
cacttatcatttgaaaatttttttcaatttttaattacagagcagcatgagcaagtggat
cgtcaaactgcatggtcatattttattaagtacagagaaccgactcagctgacgatgggg
caagatggttttaccaagttcttgaaggagcaaccatatttggtggaggttaaagaggag
ttatattcaaagccattaaaccattattttattgcatcttcacataatacttatttattg
gggaaacaaattgcagaaactccatctgtggagggatatattcaagtcctacaacaaggt
tgtaggtgcgtagaaattgatatatgggatggtgaaaatgggccagtggtatgccatgga
tttttaacgtcagctattcccttaaaaacagttatacgcgtgataaagaagtacgctttt
ataacgtctccgtatcctttgattatttcactggaaataaactgtaacaaggataatcaa
aaattggcaagcctgataatgagagaggttttagcagaacagctgtactttgttggcaca
agaactgataaactgccatcaccaagggaattaaaacataaaatactgttgaaatccaag
aagacgagtgaagcaactagaggtcttagcgttaatgagccatttccatcttcttttagt
tcttcttacgaatcagctaatgaacaggaattaagaatgaaagatgactccacgaacagt
agtagcgcaacaaattcttctagtatgcaacgcatcaaaagaattggattaaaaaagcac
gctgatataattaatgatgtttctaacatttctggaatacatggcatcaagttcaggaat
ttctctttaccagagtccaaaacgatagcgcattgtttttcactgaatgagcgcaaagta
gaatacatgataaaagacaaacacttaaaattatcgttggataaacataatagaagatat
ttgatgagagtctatcctcacgttttacgatacaaatcatcaaattttaacccaatacct
ttttggaaggccggtgtacaaatggtggctacgaattggcaaactaatgatattggacag
caacttaatctggcaatgtttcaaatattagatcaccaacctgatggaagttttaaatca
ggatacgtgctaaaaccaaaaaagttgctacctgtagtaacaaaggcgaaaatgattcca
ttaatttacgaacattttgaaaatggtagtgatcctgttactgttaaaattcgaatttta
tctacacagttattgcccagattgaatgatacatcgccaagcagaaataacaccaattcc
tttgttaaagtggagtttcataccgatgacgagccgacaatgcccatctcaatcgataag
ggtacaaggatttctgccactgaagcatccactaagagttctcaagggaatggattcaac
ccaatatgggatgctgaagtttctatcacattgaaagatacagacctcacatttataaaa
ttcatggttatctctgaagagacccagattgcatctgtttgccttaagctgaactatttg
aggatgggatatcgtcacattccgttgtttaacatggagggggaacaatacatattttgc
actttatttattcatacacaaattttatag

DBGET integrated database retrieval system