KEGG   Saccharomyces cerevisiae (budding yeast): YPR003C
Entry
YPR003C           CDS       T00005                                 

Name
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Sulfate_transp STAS MFS_MOT1 DUF1072
Other DBs
NCBI-GeneID: 856111
NCBI-ProteinID: NP_015328
SGD: S000006207
UniProt: P53394
Position
XVI:complement(561504..563768)
AA seq 754 aa
MTSNNSLLGRGRMSYSSTAPPRFKRSVDQRDTFSDNFDYDKDSSNRGRTYIAASNSTTGV
PPPNNSRSGCTNNTNNTNNTSNTSNTNNNDSVDENTVFETLPYYLPCFSWLPEYTFNKLW
GDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAI
SLVVGQAVESITLHKENVSLIDISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFIS
SVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIV
LFLTRLLKRKLMKYHKSAIFFPDILLVVIVTILISMKFNLKHRYGISIIGDFSMDNFDEL
KNPLTRPRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIV
ISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVIT
TIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKH
SAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSED
LKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTSIDSSAAQVLEEIITSYKRR
NVFIYLVNVSINDKVRRRLFKAGVAASVERAQANNNENNTSNTFSDAGETYSPYFDSIDA
ALYEIEKMKIKGNNVPNNDSESFMSNTLFNSSLV
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgacatcaaataattcgttattggggcgtggaaggatgtcatattcctctaccgctcca
ccaagattcaaaagatcagtcgaccagcgtgacactttctcggacaattttgattatgat
aaggattcatccaatcgaggcaggacctatattgcagcatctaattcaactactggggta
cccccacccaacaactcaagatcaggatgcaccaataatacaaataatacaaataataca
agtaatacaagtaatacgaacaataatgatagcgttgatgagaatacagtgtttgaaact
ttaccttattacctgccctgcttttcatggcttcctgagtacactttcaataaactgtgg
ggcgacgtaatcgcaggtatctcagtagcgtcatttcagataccacttgcgctatcgtac
acaacttcaattgcacatgtcccacctttatgcggactatattctttggctattagccca
tttgtctatggtattttaggttctgttcctcagatgatagttgggcccgaaagtgcaatt
tccttggtcgtgggacaagcagtcgaatctataacactacataaagaaaatgtttctcta
attgatatttcaacagtaataacatttgttagtggcactatcctacttttttctggtatt
tccagatttggtttccttggaaatgttcttagcaaggcacttctacgaggtttcataagt
tcagtaggactggttatgataatcaactctttgatttctgaattaaagctagacaaattt
ttagtaagcttgcctcaacactaccatacccctttcgagaaaatacttttcctcattgat
tatgcaccagcacaataccatataccaacggcaatattcagcggatgttgcttgattgtc
ctctttttaacgcgtctactaaagaggaaattaatgaaatatcacaagagcgcaatattt
tttccagatatattattggtggtaattgttactattcttatttccatgaaatttaattta
aaacacagatatggtatttctatcattggcgactttagcatggacaattttgatgaattg
aaaaaccctttaactcgtcctagacgtaagctaataccagatctttttagtgcatctcta
atagtggcaatgttgggtttttttgaatctacgaccgcgtcgaaatctcttggaacaact
tacaatcttaccgtttcctctaatagagaactagtagctttaggattcatgaatattgtc
atctcattattcggtgctcttcccgcattcggcggatatggaagatccaagatcaacgcc
ctatcaggagcacaaagcgtaatgtcgggagtgtttatgggtgtcatcaccctaatcaca
atgaatttacttcttcaattcgtacattatattcctaattgtgttttatccgtcataaca
accatcatcggaattagtttattagaggaagtgccaggcgacataaagttccatttgcga
tgtggtggctttagtgaactatttgtttttgctgttaccttctgcactacaatattttac
tcaatcgaagcaggaatatgcatcggatgtgtctattcaattataaatattataaagcat
tcagcaaagtcaagaatccaaattctggctagggtagcgggaacgtcgaactttacgaat
cttgacgactacatgatgaacatgaaaaggaactctctggatgttgagggcacagaagaa
atcgagggatgcatgattgttagaatacctgagcctctcacatttacaaacagcgaagat
ttaaaacagagacttgacagaatagagaggtacggttcgtctaagatacatcctggaagg
aaatcacttcgctcgaaggattccataaaatatgtcattttcgatttaggtgggatgacc
tcaatagattcttcagccgcccaagtgctggaggaaattatcactagttacaagaggcgc
aatgtctttatttaccttgtcaatgtatctataaatgacaaagtaagaaggcgattattc
aaagcaggtgtagctgctagtgtggaaagagcgcaagcaaataacaacgaaaataatact
agcaacacatttagtgatgcaggagagacatattctccgtacttcgatagcattgatgcg
gctctttatgaaattgagaaaatgaaaattaaagggaacaacgtcccgaacaatgattcg
gagagttttatgtccaatactttatttaattcaagtctagtgtaa

DBGET integrated database retrieval system