KEGG   Saccharomyces cerevisiae (budding yeast): YPR021C
Entry
YPR021C           CDS       T00005                                 

Gene name
AGC1
Definition
(RefSeq) amino acid transporter AGC1
  KO
K15105  solute carrier family 25 (mitochondrial aspartate/glutamate transporter), member 12/13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPR021C (AGC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YPR021C (AGC1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 856132
NCBI-ProteinID: NP_015346
SGD: S000006225
UniProt: Q12482
Position
XVI:complement(600649..603357)
AA seq 902 aa
MEQINSNSRKKKQQLEVFKYFASVLTKEDKPISISNGMLDMPTVNSSKLTAGNGKPDTEK
LTGELILTYDDFIELISSSKTIYSKFTDHSFNLNQIPKNVFGCIFFAIDEQNKGYLTLND
WFYFNNLLEYDNYHLIILYEFFRKFDVENLKAKQKKELGSSSFNLKAADDRIKSINYGNR
FLSFDDLLLNLNQFKDTIRLLHESIDDNFVKDNKLLLDWNDFRFLKFYKCYHENEEYLSL
NSLVTILQNDLKNEKIFIGFDRLAQMDSQGHRLALSKNQLTYLLRLFYSHRVSADIFSSL
NLSNTELLKADNNSIPYNVFKDIFYLFQNFDLLNQIFHKYVTENNLNEQDIREQIVTKND
FMTVLNAQYNKVNNIIEFSPSQINLLFSIVANSKENRRLRKRNQDRDDELLNDHHYDSDI
DFFIHNEYLHGVSRSRKNLESFNDYYHDLSDGFDQDSGVKKASKASTGLFESVFGGKKDK
ATMRSDLTIEDFMKILNPNYLNDLVHQMELQKNQNESLYINYYFYPIFDSLYNFSLGSIA
GCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPE
KAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVG
ENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKT
KRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEE
SFRSFFKGGGARVLRSSPQFGFTLAAYELFKGFIPSPDNKLKSREGRKRFCIDDDAGNEE
TVVHSNGELPQQKFYSDDRKHANYYYKSCQIAKTFIDLDNNFSRFDSSVYKNFQEHLRSI
NG
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggagcaaatcaattcgaacagtagaaaaaagaagcaacaattggaagtattcaaatat
tttgcaagtgtccttacaaaagaggacaagcctattagtatcagtaatggtatgttagat
atgccgacagtgaactccagtaaactcacagcaggaaatgggaaacctgacacggagaag
cttacaggagaactaattttaacatacgacgatttcattgaactgatatctagctcaaag
actatttattcgaagtttacggaccattcgttcaatttgaaccagatacccaagaacgtt
ttcgggtgtattttcttcgctattgatgaacaaaacaagggatatctgacgcttaatgat
tggttttattttaataatttattagaatatgataattatcatctcattattctatatgag
ttctttaggaaatttgatgtagagaatttgaaggcaaaacaaaaaaaagagcttggtagt
tcgtcgtttaatttaaaggctgcagatgatcgaattaagtcaattaattatggtaacaga
tttctaagctttgatgatcttcttttgaatctgaaccaattcaaagatactatccgcctg
ttgcacgaatctattgatgataattttgttaaagataacaaattactacttgattggaat
gactttcgatttctgaaattttacaaatgttatcatgaaaatgaagagtatttgagttta
aactctctggtcacgattttacaaaatgatcttaagaatgaaaaaatatttataggtttt
gataggttggcacagatggactcacaagggcatcgtttagccctaagcaaaaatcaactc
acctatcttctaaggttattttactctcacagggtgtctgcagatatattttcctccttg
aatctatcaaacaccgaattactaaaagcggacaataattccattccgtacaatgtattc
aaggatatattttatttatttcaaaattttgacctactgaaccaaatatttcacaagtat
gttactgaaaataatttgaatgagcaggatattagggaacaaatagttactaaaaatgac
tttatgacagttttaaacgcccagtataacaaagtaaacaatatcattgagttctctcct
tcccaaatcaacctactattttctatcgtcgcaaattcaaaggaaaacagaagattaaga
aagagaaatcaagatcgagatgacgagctattaaatgatcaccattatgattcagatatt
gatttttttatccataatgagtatttgcatggagtaagcagatccagaaaaaatttagaa
agttttaatgactattatcatgatctctcggatggatttgaccaagactctggtgttaaa
aaagcttcaaaagcgagtactggcttgtttgaatctgtatttggaggtaaaaaagataaa
gcaacgatgcgttctgacttaacaattgaagatttcatgaaaattttgaacccaaattac
ctgaacgacttagttcaccaaatggaattgcaaaaaaatcaaaatgagtcattgtatatt
aattactacttttatccaattttcgattcgttgtacaatttctccttgggttctattgcg
ggttgtattggtgcaactgtagtatacccaatagactttataaaaacaaggatgcaagcc
caaagatctttagcccaatacaaaaactcaattgattgtttgttgaagattatatcccgc
gaaggaataaaaggtctctactctggcttagggccacaattaataggagttgctcctgaa
aaggcgataaaattgactgtcaatgattttatgagaaacaggttgactgataaaaacggc
aagctaagcctttttcctgaaattatttctggcgcttcagctggtgcatgtcaagttata
tttactaatccgttagagattgtaaaaattaggctacaggtccaatccgactatgttggt
gaaaacatacaacaagccaatgaaactgccactcaaatagtcaaaaaattaggactgagg
ggcttgtacaatggtgtagccgcatgtttaatgagagatgttccattctctgctatttat
tttcccacttatgcacatttaaaaaaagatctctttgattttgatccaaatgataaaaca
aagaggaatcgattaaaaacatgggagcttttaactgccggtgccattgctggtatgcca
gctgccttcttgactactccttttgatgttataaaaacaaggctccagatagatcctcga
aaaggtgagacaaagtataacggtatatttcatgctatccgaactatcttaaaggaagag
agctttagaagctttttcaaaggtggtggagcccgtgtcctaagaagttctccccaattt
gggttcactctggccgcctatgaattattcaagggctttattccctcccccgataacaaa
ttaaaaagcagagagggtaggaagagattttgtatcgatgacgacgcaggcaatgaagag
acagtagttcatagtaacggtgaactcccacagcaaaagttttactctgatgatagaaaa
catgccaattattactataaaagctgtcaaattgcgaaaacattcattgatttggacaat
aacttttctaggtttgactcttcagtttataaaaactttcaagagcacctaagaagcatt
aacgggtga

DBGET integrated database retrieval system