KEGG   Saccharomyces cerevisiae (budding yeast): YPR040WHelp
Entry
YPR040W           CDS       T00005                                 

Gene name
TIP41
Definition
(RefSeq) Tip41p
  KO
K17607  type 2A phosphatase activator TIP41
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YPR040W (TIP41)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YPR040W (TIP41)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     YPR040W (TIP41)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIP41
Motif
Other DBs
NCBI-GeneID: 856153
NCBI-ProteinID: NP_015365
SGD: S000006244
UniProt: Q12199
Position
XVI:647305..648375
Genome map
AA seq 356 aa AA seqDB search
MSKRNTPPLRSSGINTIQINAAREMHAQTVRARRMPMPTSGITTPSVQPTAAPATPPRHI
CNNPNNPQCLHCGSVIIPSPRATLPLEDNPSISINDWTISSRKKPILNSQELDIWENEKL
KGLTLPEMIFGNNYIRIENSKQHWSIEFNALDALKEVQLQDSGIRVAYSNDWINSKKRQN
STNGAQRFTNDVNDDSLNIIHKYDWTYTTRYKGTESSPESKFRLDNDQKLPLDKLAVHDK
ILFYDDMILFEDELADNGISILNVKIRVMNERLLLLSRFFLRVDDVLVRVYDTRIYVEFD
ENVVIRESKEFEGKYQDVLAKHRLSQSHDPKAALRDSNWVAQNTPMIKRQCEIIQF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagaaacactccaccgctcagatcatcagggataaacactattcaaataaat
gctgctagagaaatgcacgctcaaacggtgcgcgctcgaagaatgcccatgccaactagc
ggcatcactacaccctctgtgcaaccaactgcagccccagcaacaccacctcgacatatt
tgcaataacccaaacaatccgcagtgtctccactgtgggtctgttatcattccatctcca
agggccacgttacccttggaggacaacccctccatctccatcaacgactggaccatctcc
tccagaaagaagcccattttgaactcgcaggaattagacatctgggaaaacgaaaaactc
aaaggtttgactttgccagagatgatttttggtaacaactacatcaggatcgaaaattca
aaacagcattggtccatagagttcaatgccctggatgctttaaaggaggttcaactccag
gattcaggtattcgtgttgcgtactcaaacgactggataaattctaaaaaaagacaaaat
tcaactaatggtgcgcaacggttcactaacgatgtgaacgacgattccttaaatatcata
cacaagtacgactggacctacactacgcggtataagggcacagagagctcacctgagtcg
aaattccgactggataacgatcaaaagctgccccttgacaaactggccgtacacgataaa
atcctattctatgacgacatgattcttttcgaagacgaattggcagacaatggcatatca
atccttaacgtcaaaataagagttatgaacgaaaggttactgctgctgagccggttcttt
ttaagggtggacgatgttctggtgagggtctacgacaccaggatttacgtggagtttgac
gaaaacgtagtgatcagagaatccaaggaatttgaaggtaaatatcaggatgtacttgct
aagcaccggctatcccaatctcacgacccaaaagctgccttgagagatagtaattgggta
gcacagaacacgccgatgatcaaaagacaatgtgaaataattcagttctaa

DBGET integrated database retrieval system