KEGG   Saccharomyces cerevisiae (budding yeast): YPR041WHelp
Entry
YPR041W           CDS       T00005                                 

Gene name
TIF5, SUI5
Definition
(RefSeq) translation initiation factor eIF5
  KO
K03262  translation initiation factor 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YPR041W (TIF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YPR041W (TIF5)
Translation factors [BR:sce03012]
 Eukaryotic Type
  Initiation factors
   eIF-5
    YPR041W (TIF5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-5_eIF-2B W2 End3
Motif
Other DBs
NCBI-GeneID: 856154
NCBI-ProteinID: NP_015366
SGD: S000006245
UniProt: P38431
Structure
PDB: 

Position
XVI:648704..649921
Genome map
AA seq 405 aa AA seqDB search
MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFE
LGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRD
CKACGKRTPMDLRHKLSSFILKNPPDSVSGSKKKKKAATASANVRGGGLSISDIAQGKSQ
NAPSDGTGSSTPQHHDEDEDELSRQIKAAASTLEDIEVKDDEWAVDMSEEAIRARAKELE
VNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDI
VNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEE
IMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAESDDDEEDDE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaatatttgtagagataatcatgatccattttaccgttacaaaatgcctccc
atccaagccaaggtggaaggtagaggtaacggtatcaagactgccgttttgaacgtcgct
gacatctctcacgcgctaaatagacctgctccatatattgtcaagtattttggtttcgaa
ttaggtgctcaaacttccatctctgttgacaaagatcgttatttagttaatggtgttcac
gaacctgccaaattgcaagacgtattggatggctttattaacaagtttgttctctgtgga
agctgtaaaaatccagaaacggagatcatcattaccaaagataatgatttggttcgagac
tgtaaagcctgtggtaagagaactccaatggacttgagacataaactatcatccttcatt
ttgaaaaacccacctgactccgtttctggttccaagaagaagaagaaagcagctaccgct
tcggccaatgttcgtggtggtgggttgtccattagtgatattgctcaaggtaagtctcag
aatgcaccttcagatggcaccggctcatccactccacaacatcatgacgaagacgaagat
gaattatctcgtcaaatcaaggcggctgcctctaccttagaagatatcgaggtcaaagat
gacgaatgggcggttgatatgtctgaagaagccattagagctcgtgccaaggaactagaa
gtgaactctgagctcactcaactggatgaatatggtgaatggattttggagcaggctggt
gaagataaggagaacttaccatcagatgtggagctttataagaaggctgcagaactagac
gtcttgaatgatccaaaaattggttgtgtcttggcgcaatgtctattcgatgaggatatc
gtaaacgaaatcgctgaacataatgcatttttcactaaaattttagtcactccagaatac
gaaaagaactttatgggtggtattgaaagatttttaggtttagaacataaggatctaatc
ccactattaccaaaaattttggtacaactatacaataatgatatcatctcggaagaagaa
atcatgagatttggtaccaaatcatccaagaaatttgtacctaaggaggtatccaaaaag
gttcgtagggctgctaagccattcattacgtggttagaaaccgctgaaagtgacgatgat
gaagaagacgacgaatag

DBGET integrated database retrieval system