KEGG   Saccharomyces cerevisiae (budding yeast): YPR047WHelp
Entry
YPR047W           CDS       T00005                                 

Gene name
MSF1
Definition
(RefSeq) phenylalanine--tRNA ligase
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00970  Aminoacyl-tRNA biosynthesis
Module
sce_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YPR047W (MSF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YPR047W (MSF1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YPR047W (MSF1)
Enzymes [BR:sce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     YPR047W (MSF1)
Amino acid related enzymes [BR:sce01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   YPR047W (MSF1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    YPR047W (MSF1)
 Prokaryotic Type
    YPR047W (MSF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2d FDX-ACB DUF3811
Motif
Other DBs
NCBI-GeneID: 856160
NCBI-ProteinID: NP_015372
SGD: S000006251
UniProt: P08425
Position
XVI:657529..658938
Genome map
AA seq 469 aa AA seqDB search
MFLNRMMKTRTGLYRLYSTLKVPHVEINGIKYKTDPQTTNVTDSIIKLTDRSLHLKESHP
VGILRDLIEKKLNSVDNTFKIFNNFKPVVTTMENFDSLGFPKDHPGRSKSDTYYINETHL
LRTHTSAHELECFQKIRNDSDNIKSGFLISADVYRRDEIDKTHYPVFHQMEGATIWKRTK
ADVGVKEPMYIEKIREDIRQVENLLNKENVKITVDDDTIPLKENNPKQEYMSDLEVDLCS
QHLKRSIELIVSEVFNKKISSMIKNKANNTPKELKVRWINAYFPWTAPSWEIEVWWQGEW
LELCGCGLIRQDVLLRAGYKPSETIGWAFGLGLDRIAMLLFEIPDIRLLWSRDERFSRQF
SKGLITSFKPYSKHPGSFRDVAFWLPEDKPDIHQVHENDLMEIIRNIAGDLVESVKLVDS
FTHPKTGRKSMCYRINYQSMDRNLTNAEVNTLQDMVCSKLVKEYSVELR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcaatagaatgatgaagaccaggactggtctttatcgcttatattcaaccctt
aaagttccacatgtagaaatcaatggcataaaatacaagaccgacccacagactaccaat
gttacagattcaataataaagcttaccgacagatcattacatttgaaagaatcacatcca
gtaggcattcttcgcgatctaattgaaaagaaattaaactcagtcgacaacacatttaag
atctttaataatttcaagcccgtggtaaccacaatggaaaacttcgattctttagggttt
cctaaggatcatcctggaagatcaaaatctgacacatattatataaatgagacgcaccta
ctgagaacacatacttcagcccacgaattagagtgctttcaaaaaataagaaacgattca
gataatattaaaagtggatttttaatatctgcagatgtgtacagaagagatgaaattgac
aaaactcactatccggtattccaccaaatggaaggagccacaatttggaaacgaacgaag
gctgatgtgggcgtaaaggagccaatgtatatcgagaaaatccgtgaagatatcagacag
gtagagaaccttttaaataaagaaaatgtaaagattacggttgacgatgatactatacct
ttgaaagaaaataatcctaaacaagagtatatgtccgatctggaggttgatttgtgctct
caacatttgaagaggtccattgaactgatagtttctgaagtttttaacaaaaaaatatct
agcatgatcaagaacaaagcgaataatacacccaaagagctaaaagtccgttggattaac
gcttacttcccctggaccgcgccctcatgggaaatagaggtttggtggcagggcgaatgg
ctcgaactctgcggatgcggattgattcgtcaagatgtgctactaagagccggatataaa
ccttctgaaacaattgggtgggcttttggcttgggtttggaccgcattgctatgcttctt
tttgaaattccagatattagactgctttggagtcgtgatgaaagattttcaagacaattc
tccaagggattaattacttccttcaaaccttattcaaaacacccgggatcatttagggat
gttgcgttttggttaccagaagataaaccagatattcatcaagttcatgaaaatgatttg
atggaaattatcagaaatatagctggcgatttggtagagagtgtcaagctagtcgatagc
tttacgcatccgaaaactgggagaaaatctatgtgctacaggatcaactatcaatcaatg
gacagaaatttgacaaacgccgaagttaacactttgcaagacatggtgtgttctaaattg
gtaaaagaatacagcgtagaactcagatag

DBGET integrated database retrieval system