KEGG   Saccharomyces cerevisiae (budding yeast): YPR048WHelp
Entry
YPR048W           CDS       T00005                                 

Gene name
TAH18
Definition
(RefSeq) NAPDH-dependent diflavin reductase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 856161
NCBI-ProteinID: NP_015373
SGD: S000006252
UniProt: Q12181
Position
XVI:659182..661053
Genome map
AA seq 623 aa AA seqDB search
MSSSKKIVILYGSETGNAHDFATILSHRLHRWHFSHTFCSIGDYDPQDILKCRYLFIICS
TTGQGELPRNVNALKGERPVTFWSFLKRKNLPSNLLNHIQTAMLGLGDSSYPKFNYGIRK
LHQRIVTQLGANELFDRLEADDQAMAGSNKGTGLGIESVYFEYEKKVLSFLLSKYPNRKV
NGQIIKREELDPEVYLEPASYLQLSDEHANEKFTSTKVIFEGDESLKVGRVNINKRITSE
GHFQDVRQFKFSNVDKIQENYEPGDTVTIYPCNTDEDVSRFLANQSHWLEIADKPLNFTS
GVPNDLKDGGLVRPMTLRNLLKYHCDFMSIPRTSFFLKIWTFATDVTKMERGQEQLNDQR
EKLRQFATDQDMQDLYDYCNRPRRSILEVLEDFISVKLPWKYVLDYLPIIKPRYYSISSG
PGDPNIELTVAIVKYKTILRKIRRGICTNYIARLQEGEQIRYKLQNNHIIKKEFLNKPMI
LVGPGVGLAPLLSVVKAEISKDIKLLFGCRYKDKDYIYKDMLEDWFRKGKIALHSSFSRD
EENSPGVKYVQDYLWRLGEEITNLVVNKDAVFFLCGSSGKMPIQVRLTFIEMLKKWGNFS
DEETAKKYLKEMEKSDRYIQETW
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgagcaagaaaatcgtcatcctctatggatcggagacaggtaacgcgcatgat
tttgctacaatcttatcccatcgactacatcgctggcatttctcccatacattttgctcc
attggtgattatgacccacaggatatcttgaaatgcaggtacctttttattatatgctcc
acaacaggccaaggtgaattaccaaggaatgtcaatgcattaaaaggtgaaagacccgtc
acgttctggtcgtttttaaagagaaagaatcttccgtcgaatttgctcaaccatattcaa
actgccatgcttggacttggtgattcatcttatcctaagtttaactacggcattagaaag
ctacatcagcgcattgtcacacaattgggtgctaatgaattattcgatagattggaggct
gacgaccaggctatggctggtagcaataagggtacaggtctcggaattgaatcagtatat
tttgaatatgaaaagaaagtcctaagctttcttttaagtaagtaccccaacagaaaggtc
aatggccaaataattaagagggaagaattggaccctgaggtttacctagagccagcatcc
tacctacagctttcagacgaacatgccaatgaaaagttcactagcaccaaggttatattc
gaaggtgatgaatcgttaaaggttggcagagttaatataaacaaaaggattacatctgaa
ggtcatttccaagacgtgaggcagttcaagtttagtaatgtggacaagattcaagaaaac
tatgaacccggtgatacagtaaccatatatccttgcaatacagatgaggatgtttcaaga
ttcctagcaaatcaaagccattggttagaaattgcggacaaaccattgaatttcaccagt
ggagttcctaatgatcttaaggatggtggattagttcgcccgatgactttaaggaacttg
ttgaaatatcactgtgatttcatgagcattcctagaacaagttttttcttgaagatttgg
acctttgcaactgatgtaactaagatggaacgtggccaagaacaactgaatgatcaaaga
gaaaaattgcgccaatttgctactgatcaagatatgcaggacttatatgactactgtaat
agacccagaaggtcaattcttgaagtactggaagattttatctccgtaaagttgccctgg
aaatatgtgctagattacttgcccatcattaaaccaaggtactactctatatctagcggc
cctggggatcctaatattgaattaacagttgcgatagtaaaatataaaactatcttaagg
aaaattcgaagaggaatttgcactaactacattgcacgattgcaagagggggaacagata
aggtataagttacaaaataatcacataatcaaaaaggaatttttgaataaacctatgatt
cttgtcggaccgggtgtcggtctagcaccattattatcagtggttaaagcggagatatct
aaagatatcaaactcctcttcggttgtagatataaagataaagattatatttataaagat
atgctggaagattggttccgtaagggcaaaattgccttacattcatccttttccagagat
gaggaaaattcaccaggtgttaaatatgtccaagactacttatggagattaggtgaggaa
ataactaatttggtagttaataaagacgccgtttttttcttatgtggctcatcaggtaaa
atgcctatccaagtcagattaacattcattgaaatgttaaaaaaatggggcaattttagt
gatgaagaaactgccaaaaaatacctgaaagaaatggaaaaatctgatagatatatccag
gaaacttggtag

DBGET integrated database retrieval system