KEGG   Saccharomyces cerevisiae (budding yeast): YPR049CHelp
Entry
YPR049C           CDS       T00005                                 

Gene name
ATG11, CVT3, CVT9
Definition
(RefSeq) autophagy protein ATG11
  KO
K08330  autophagy-related protein 11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YPR049C (ATG11)
   04136 Autophagy - other
    YPR049C (ATG11)
   04139 Mitophagy - yeast
    YPR049C (ATG11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPR049C (ATG11)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YPR049C (ATG11)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPR049C (ATG11)
Membrane trafficking [BR:sce04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Scaffold protein
    YPR049C (ATG11)
  Mitophagy
   Scaffold proteins
    YPR049C (ATG11)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    YPR049C (ATG11)
Transporters [BR:sce02000]
 Other Transporters
  Others
   YPR049C (ATG11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG11 TrbH DUF4452 ABC_tran_Xtn
Motif
Other DBs
NCBI-GeneID: 856162
NCBI-ProteinID: NP_015374
SGD: S000006253
UniProt: Q12527
Position
XVI:complement(661137..664673)
Genome map
AA seq 1178 aa AA seqDB search
MADADEYSTAPTQQEITPLQTTATIINAISGECITTNVDFFVSLDKFKQFIARKWKIPPD
QLLILLPYGNKLKPSMFKELLINRSFTLNDFYVYDRRLFSLVSKPTPTNLLTSKDSNPMN
SPNSNDLTETLEYLIKNSHISQYQGSDTIMIKPMPSPLEDADVDLSRLNYHSVTSLLTTN
LGWLSALEIDVHYFKSLIPDIIAHIKRIFDGLTVCSQYLKLYCFDVESLYNSNVQFLNQL
VDNGMTSKWEKCFNDTLSKLTALEGDSLQKFINIESLLENEKSVKILNHSINGKLNKIKR
EIDENASFRDIITVNIDRLRQMFTPNESKFELEDQMAESFEVLVSEMRTRSRNVLDKEEE
EFNSQEFLKSMNVMLEKDKKESVKTLFTISQALYSQIGELIDLKKSLQKHAVAILGNIAF
TQMEILGIKRLLLNECNKDLELYKKYEVEFAQVEDLPLIYGLYLIEKYRRLSWFQQILSF
ISNFNQDLELFKQNELRTRNKWVKNFGSIATVFCEDLLSSSDFKRLNEYHSHTSPPNEDE
EDENENSIANYRQDLVKVSQAIDNYMTQIKETDVSEPIIDLLSKTLFETKRFHIIYSNFK
NNNNNSSNGNSISPEGSIALKSDDVVKGYKTRIKKLESLLHEFQYSDIGHWPQGVLNTHL
KPFRGSATSINKKKFLGASVLLEPANISEVNIDSVSQANNHQIQELESNVDDLLHQLQLL
KEENNRKSMQISEMGKKISDLEVEKTAYRETLTNLNQELARLTNEEQSHRTEIFTLNASF
KKQLNDIISQDNEKIEKLTGDYDDVSKSRERLQMDLDESNKKHEQEVNLLKADIERLGKQ
IVTSEKSYAETNSSSMEKGEKFETIPLAEDPGRENQISAYTQTLQDRIFDIISTNIFILE
NIGLLLTFDNNNNIQIRRVKGLKKGTAQSNILDESTQMLDAHDNSLIKSPVFQKLKDEYE
LIKSVANGSEKDTQQSIFLGNITQLYDNKLYEVAVIRRFKDIETLAKKLTKENKIKRTLL
ERFQREKVTLRNFQIGDLALFLPTRENVNSVGSMSSSTSSLSSSFSSVDLSTPPPLDAMS
IQSSPSVIHSNVINQASISGRDKNKLMRPWAAFTAFEESTRYFLKDEKGLTKGKEWFVGR
IVTLEHFVADSPSNNPFRLPKGSVWFQVTAVVVSYQGV
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgctgatgaatatagcactgcacctacccagcaagaaataacaccactgcag
acaacagccactatcataaatgcaatatctggagaatgtataactacgaatgttgatttt
ttcgtttccctggacaaatttaaacagttcattgctaggaaatggaagattcctcccgat
cagctgctgattctactaccttatggtaacaaactaaaaccgtcgatgtttaaagagctg
cttattaataggtcttttactctaaatgatttttacgtttacgacagacgactattctca
cttgttagtaaaccgacaccaacaaatcttttaacgtctaaggattctaatcccatgaac
tcccctaattccaacgacttgacagagactctggaatatttaattaagaatagtcatata
tctcaataccaaggtagcgatactattatgatcaagcctatgccctcgcctttggaggac
gcagacgtagatctttcgcgtttaaattaccattccgtaactagcttactgacgacgaac
cttggttggctaagcgctttagaaatagatgtacattattttaagagcctcataccagac
ataatagcccatattaagcgtatttttgatggcttaaccgtttgctcacaatatttgaag
ctgtactgctttgatgtagaaagtttgtataactcaaacgttcaatttttaaatcagctg
gtagacaatggtatgacttcaaaatgggaaaaatgcttcaatgacaccttgagtaagttg
actgctttagagggtgattctttacaaaagttcattaatattgaatctctcctggagaac
gaaaaatctgtaaagattctaaatcattcaatcaatggtaagctgaataaaattaagagg
gaaattgacgaaaatgcaagttttagagatattataacagtaaacatcgatcgactgcgg
caaatgtttaccccgaatgaatctaaattcgagcttgaagaccaaatggcagagagcttt
gaggtactggtatcagaaatgcgaacaagaagcagaaatgtacttgataaagaagaagaa
gaattcaatagtcaagaatttttgaaaagcatgaatgtgatgttggaaaaggataaaaaa
gaatcagtgaaaactctcttcactatatcacaagcgctgtattcacaaataggagaacta
atagatttaaaaaaaagtctacaaaagcatgcagtagccattttgggtaacatagcattc
acccagatggaaatcctaggtattaaaagactattattgaatgaatgtaataaagattta
gagctatacaagaaatatgaggtagaatttgcacaggtagaagatttgcctctgatatat
gggctttatttaatcgaaaaatatcgtaggctatcatggttccaacaaattttgtcattt
atctcaaattttaatcaagatttagagttgttcaaacaaaatgaattacgaacaagaaat
aaatgggttaaaaatttcggttccatcgcgactgttttttgcgaagatctattgtcttcc
tctgatttcaaacgtctaaacgaatatcactctcatacttctccaccaaatgaagatgag
gaagatgaaaatgagaattctatagcaaattaccgccaagacctggtaaaagtatcgcaa
gccattgataattatatgacgcaaattaaagaaacagatgtttctgaaccgatcattgat
ctactttcgaaaacactttttgagacgaagagatttcatataatatattccaatttcaaa
aataataacaataatagttctaatggcaatagcatttcccctgaagggtctattgccttg
aaaagtgatgatgtagtcaaaggatacaaaacaagaataaaaaaattagaatcgctatta
catgagtttcaatattccgacataggccattggcctcaaggtgttctcaatacccatctt
aagccatttcgtggttctgctacgagtataaacaagaagaaattcctgggagcatctgta
ttactagagcctgccaatatttctgaagtgaacattgatagtgtttcgcaagctaataat
catcaaattcaagagttagagagtaatgtggatgatctattacaccaacttcaactattg
aaagaagaaaataatcgaaaatcaatgcaaatttcggaaatggggaaaaaaataagtgat
ctagaggtggagaagacagcttatcgcgaaactttgactaatttgaatcaagaattggca
aggttaactaatgaagaacaatcgcatagaactgaaatttttaccctcaatgcctctttc
aaaaagcaattgaatgatataattagccaagacaatgaaaagatagaaaagctaacaggt
gactatgatgatgttagcaaatcgagggaacgattgcaaatggatctggatgaatctaat
aagaagcatgaacaagaggtcaatttgttgaaggctgatattgaaaggctcggtaaacaa
attgtgacttcagagaaaagttacgctgagactaactcaagctcgatggaaaaaggtgag
aaattcgaaaccattcctcttgctgaggacccaggtagggaaaaccagatatctgcatac
acacagactctgcaagatagaatatttgatataatatcgacaaatattttcattttggag
aacattgggttgctgttaaccttcgacaataataataacatccaaattagacgagtcaag
ggattgaaaaagggaaccgcccaaagtaatatactggatgaaagcacacaaatgctggac
gcacatgataattctctaataaaaagtccggttttccagaaattgaaagatgagtatgaa
ttaataaagtcagttgccaatggatctgaaaaggatacacagcaaagcatttttctgggg
aatatcactcaattatatgacaataagctttatgaagttgccgttatcaggagattcaag
gatattgagaccttggccaaaaaattaactaaagaaaataagatcaagagaacgctattg
gagagattccaaagggaaaaggtgactttgaggaactttcaaattggcgatttagcatta
tttttgccaacacgagaaaacgttaattctgtcgggtctatgtcgtcttccacctcatca
ttgagctcatcattttcatctgttgatttatcaactccaccgcctttggatgctatgtct
atacaatcgtctccctcggtgatacatagtaatgtaatcaatcaagccagtatatctggc
agggacaagaataaactgatgaggccttgggctgcatttacagcttttgaagaaagcaca
agatattttttaaaggacgaaaaaggattgacgaaggggaaagaatggtttgtaggcaga
attgtcactttggaacatttcgtagcagatagcccctctaataatccatttagactacca
aagggctcagtttggtttcaggtcactgcggttgtggtttcataccagggagtttga

DBGET integrated database retrieval system