KEGG   Saccharomyces cerevisiae (budding yeast): YPR051WHelp
Entry
YPR051W           CDS       T00005                                 

Gene name
MAK3, NAA30
Definition
(RefSeq) peptide alpha-N-acetyltransferase MAK3
  KO
K00670  N-alpha-acetyltransferase 30 [EC:2.3.1.256]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPR051W (MAK3)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.256  N-terminal methionine Nalpha-acetyltransferase NatC
     YPR051W (MAK3)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   N-acetyl transferase complex C (NatC)
    YPR051W (MAK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_3 Acetyltransf_8 Acetyltransf_9 Acetyltransf_CG Acetyltransf_13 Acetyltransf_15
Motif
Other DBs
NCBI-GeneID: 856163
NCBI-ProteinID: NP_015376
SGD: S000006255
UniProt: Q03503
Position
XVI:664960..665490
Genome map
AA seq 176 aa AA seqDB search
MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNI
PIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETE
VENSAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTEKSCTRSTFLMHGRLAT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagtgtacaagccattggacatacgtaacgaagagcagtttgctagtattaaa
aaactaatagatgcggatctatcagagccgtactcgatatacgtatataggtatttcttg
aaccaatggcccgagttaacgtacattgccgttgacaacaagagtggaacgcctaacata
cccattggttgcatagtgtgtaagatggacccgcatagaaacgtgagactgagaggatat
ataggaatgctagccgtagagtccacataccgcgggcatggcatagcaaagaaactagtg
gaaattgccatagataaaatgcaaagggaacattgcgatgagatcatgttagaaacagag
gtggaaaattcggcggctctaaacttatatgaaggaatgggtttcatcagaatgaaacgg
atgttccgctactacttgaatgaaggggacgcctttaaactgatattgccgttgactgaa
aagagctgcactcggtctacgttcctaatgcatggccggctggccacataa

DBGET integrated database retrieval system