KEGG   Saccharomyces cerevisiae (budding yeast): YPR052C
Entry
YPR052C           CDS       T00005                                 

Gene name
NHP6A
Definition
(RefSeq) high-mobility group nucleosome-binding protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: HMG_box HMG_box_2 Ccdc124 YABBY
Other DBs
NCBI-GeneID: 856165
NCBI-ProteinID: NP_015377
SGD: S000006256
UniProt: P11632
Structure
PDB: 
1LWM 1J5N 1CG7

Position
XVI:complement(665693..665974)
AA seq 93 aa
MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWK
ALTPEEKQPYEAKAQADKKRYESEKELYNATLA
NT seq 282 nt   +upstreamnt  +downstreamnt
atggtcaccccaagagaacctaagaagagaaccactagaaagaagaaggacccaaatgcc
cctaagagggctttgtccgcctacatgtttttcgctaacgaaaacagagatattgttcgt
tctgaaaatccagatatcacatttggacaagtcggcaagaagttgggtgagaagtggaag
gctctaacgccagaggaaaagcagccttacgaggccaaggcccaggccgataagaagaga
tatgaatccgaaaaggagttatataacgccactttggcttag

DBGET integrated database retrieval system