KEGG   Saccharomyces cerevisiae (budding yeast): YPR054WHelp
Entry
YPR054W           CDS       T00005                                 

Gene name
SMK1
Definition
(RefSeq) mitogen-activated protein kinase SMK1
  KO
K08293  sporulation-specific mitogen-activated protein kinase SMK1 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YPR054W (SMK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   YPR054W (SMK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 856167
NCBI-ProteinID: NP_015379
SGD: S000006258
UniProt: P41808
Position
XVI:666280..667446
Genome map
AA seq 388 aa AA seqDB search
MNCTLTDNTRAINVASNLGAPQQRTIFAKERISIPGYYEIIQFLGKGAYGTVCSVKFKGR
SPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCY
QELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCL
KICDFGLARGIHAGFFKCHSTVQPHITNYVATRWYRAPELLLSNQPYSKSVDIWAVGCIL
AEFYARKPVFMGRDSMHQIFEIIKVLGTPDKDILIKFGTIKAWNLGKNSNNPVYKKIPWS
NIFPFASHEAINLIESLLHWDSTHRLNVEQAISHPFLNEVRKPDDEPVCLQGPFDFTYES
ELNSMSKLRDYLVEEVKNFKTDLSSSSL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcacacttacagataataccagagccataaatgtggcctccaacctcggtgct
cctcaacagaggacgatttttgccaaggagagaatatccatcccaggatactacgagata
atccaattcctgggcaagggagcctatgggacagtgtgctcagtgaagtttaagggtcga
agcccagctgctaggatagcggtaaagaagatcagcaacatctttaataaggagatcctt
ttgaaaagggccatccgtgagctaaaattcatgaacttcttcaagggccataaaaatatt
gtaaatctaatcgatctagagatagtgaccagctcgccctatgacggactgtattgctac
caggaactgattgattatgatttggcaaaagtcatacattcgtccgtgcagctctcggag
tttcatatcaaatactttctttaccaaatcctgtgtgggctaaagtacatacacagtgca
gatgtcatccaccgagatttgaagcctgggaacatattgtgcacattgaatggctgtttg
aagatctgcgattttggtctcgctaggggtattcatgccggatttttcaagtgtcattcc
actgtgcagccccatataaccaactacgttgctacaagatggtatagggcgcctgagctg
cttctttccaaccaaccgtatagtaagtccgtagacatatgggctgtagggtgcattctt
gcagaattctatgctcgaaagcctgttttcatggggcgtgactccatgcaccagatattt
gaaatcatcaaagtcttgggtactcctgataaagatattctgatcaagtttggcaccatt
aaagcttggaatctaggcaaaaacagtaataaccctgtatataaaaaaatcccatggtcc
aacattttcccctttgcctcgcatgaagcaatcaatctcatagagtcattacttcattgg
gactcaacacataggttaaacgtggaacaagctatatcacatccgttcctaaacgaggtg
cggaagccagacgacgagcctgtttgccttcagggtcctttcgacttcacctatgaatcc
gagttgaattcaatgtccaaattaagagactacttggttgaagaagtgaaaaatttcaaa
accgatttgtcctcctcgtctttatag

DBGET integrated database retrieval system