KEGG   Saccharomyces cerevisiae (budding yeast): YPR055WHelp
Entry
YPR055W           CDS       T00005                                 

Gene name
SEC8
Definition
(RefSeq) exocyst subunit SEC8
  KO
K06111  exocyst complex component 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPR055W (SEC8)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    YPR055W (SEC8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec8_exocyst Sec5 DUF2451 T3SSipB
Motif
Other DBs
NCBI-GeneID: 856168
NCBI-ProteinID: NP_015380
SGD: S000006259
UniProt: P32855
Structure
PDB: 

Position
XVI:667676..670873
Genome map
AA seq 1065 aa AA seqDB search
MDYLKPAQKGRRRGLSINSLSETQQSAMNSSLDHLQNDLNRINLQWNRILSDNTNPLELA
LAFLDDTSVGLGHRYEEFNQLKSQIGSHLQDVVNEHSQVFNTNVASYGKAVSSIMQAQEQ
TLNLKNCLKEANEKITTDKGSLQELNDNNLKYTKMIDVLVNIEELLQIPEKIEENIRKEN
FHQVQILLERGFILMNNKSLKTVEILKPINQQLELQEHLLFNNLIEEIHDIMYSKSNKTN
FTRVTNNDIFKIISISHNGFTSLENYLYNIVNIDIMEHSKTINKNLEQFIHDQSLNKGNI
MLQENAATQAPLAPSRNQENEGFNRIGFLLKTINNINKLPVAFNIITERAKEEIHNIIVK
STESIRSKHPSLLKMATSLKNDNHFGLPVQDILSIILRECFWEIFLKLLYAIQCHRAIFE
MSNILQPTSSAKPAFKFNKIWGKLLDEIELLLVRYINDPELISSNNGSIKPINGATNNAP
TLPKRKNPKIFSLEYNIEDNSSVKDQAFELKALLKDIFPGFSVSSNMDLDSIYVKDESFE
QDEPLVPPSVFNMKVILDPFLLFTQSTSTIVPSVLTQNTISSLTFFDDYMNKSFLPKIQM
TMDYLFTVEVESNNPYALELSDENHNIFKTALDFQRLFYNLLNVFNTANTFREKISYCIL
DLLNHFYNYYLGLFNSLIGTSDRHLTRKIITAWLQNGILMDQEQKILNGDETLFHEESIE
LFKEIPHFYQAGKGLSKSDLFNNLTLDTILQFSASVLWILNWLPGLKKAINIDEVSQEPM
LDADRLRSSWTFSESMDLNYSNPSSSPNSLGNLKILLDDKASKKFDETIDGFKTLKFKLI
TILRFNIRALCIYDIGSFFQNTKIWNMDVGSIELDQNIASLISELRRTESKLKQQLPEKE
KNSIFIGLDIVNNYALIKGAKSIKVLNHNGIKKMLRNVNVLQHAYRNLSSEPSKINMNVT
MNFYSLCGSSEAELFEYIKDNELPHCSVEDLKTILRLQFSEEMHRQLKRQSTSSTKGSIK
PSNKRYTEALEKLSNLEKEQSKEGARTKIGKLKSKLNAVHTANEK
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggattacctaaaaccagcgcagaaggggagaagacgtggtctttccataaacagtctt
tcggagactcagcaatctgctatgaatagttccctggaccatcttcagaatgacttaaac
aggataaatcttcaatggaatagaatactgtcggataacactaatcccttagaactagcg
ctcgcatttttggatgatacatctgtaggtctgggccaccggtatgaagaattcaatcaa
ttaaagtcacaaattggtagtcacttacaagatgttgttaatgaacatagccaagtgttc
aacactaatgtggcttcttacggaaaagcagtcagttcgatcatgcaggcccaagaacag
actttaaatctgaaaaattgtttaaaggaagctaatgagaaaatcaccactgataaaggt
tctttacaggaattaaatgataataacttgaagtatacaaaaatgattgatgttttagtc
aatattgaggagttattacagatacccgaaaaaattgaggagaacattagaaaggaaaat
ttccatcaggtgcaaattctcctagaaaggggtttcatattaatgaacaacaaatctttg
aagacagtggagattttaaagcctataaaccaacaacttgagttacaagaacatttactt
ttcaacaatctgattgaagaaattcacgacattatgtactccaaatctaacaaaacaaat
tttactcgagtaaccaataatgatatattcaaaatcataagcatttcacataatggattt
acgagtttagaaaattacctgtacaacatagtcaatattgatattatggaacactcaaaa
acgataaacaagaaccttgaacaattcattcatgaccaatcgttaaataaaggaaatatc
atgctacaagaaaatgctgcgactcaagcaccattggcaccatctagaaaccaagaaaac
gaaggatttaacagaatagggttcctactaaaaaccataaataacatcaataaattacct
gttgcattcaatataataacagaaagggctaaagaggagattcataatataattgttaaa
agtaccgaatcaatacgttcgaagcacccttctctgcttaaaatggctactagtttaaag
aatgacaaccattttggcctacccgtacaggatatactatcgatcattttaagggaatgc
ttttgggaaatatttttgaaattactgtatgctattcagtgccatagggctatttttgaa
atgtcaaacattttgcagccaacgtcttccgcaaagccagctttcaagttcaataaaatt
tggggcaaactgttagatgaaatagaattattacttgtgaggtacatcaatgaccctgaa
ttgatatccagcaataacggtagtattaaaccaattaatggcgcgacaaataacgcaccc
actttacctaaaaggaaaaatcctaaaattttttctttggagtataacattgaggacaat
tcttctgtaaaggatcaagcttttgaactaaaggctttgttgaaagatatattccctgga
ttttctgtctcctcaaacatggatttagactctatttatgtaaaagatgaatccttcgaa
caagatgagcctctagtccctccttctgttttcaacatgaaggtaattttagatccgttt
ttgctgtttacgcaatcgacatctacaattgttcccagtgtcttaacacaaaatactatt
tcatccctaacctttttcgatgattatatgaataaaagttttctcccaaagattcagatg
actatggattatttattcacggttgaagtagaatccaataatccgtacgccttagagcta
tccgatgaaaatcataacatttttaaaacagcattagattttcaaaggttattttacaat
ttattgaatgttttcaacacagcaaacacatttagagaaaaaatatcgtactgcattcta
gatcttttgaatcatttttataattactacttggggctatttaattccttgattggtact
tctgatagacatttaactaggaaaataattacggcatggttgcagaatggtattttgatg
gatcaagaacaaaaaattctgaatggggatgagacactctttcatgaagaatccatagag
ttatttaaggaaatacctcatttctatcaagcgggtaaaggtttgagcaaatctgattta
ttcaataacttgacattggacacaattctgcagttttcggcaagcgtgttatggatatta
aactggctgccaggcttaaaaaaggctatcaatattgatgaagtaagccaagaacccatg
ttagatgctgatagattaaggagcagctggacattttctgaatcaatggatttaaactat
tcgaaccctagttccagcccaaattcattaggaaatctaaaaattttattggatgataaa
gcctccaaaaaatttgatgagactatcgacggattcaaaaccttgaaattcaaactaatc
actatactgaggttcaacattagggccttgtgtatatacgacatcgggtctttttttcaa
aacaccaaaatttggaatatggatgtgggtagtattgaattagatcaaaatatagcttct
ctaatttccgaattaagaaggactgaaagcaaattgaaacaacagttaccagaaaaggaa
aaaaactccatatttattggtcttgatatagtcaacaactacgccttgattaagggtgcc
aaatccataaaagttttgaaccataacgggataaagaaaatgttgagaaatgtaaatgtc
ttacaacatgcctatagaaatctttcttctgaaccatcaaaaattaatatgaacgtcaca
atgaatttttactctttatgcggctccagtgaagctgaactatttgaatatataaaagac
aatgaattaccgcattgttctgtcgaagatttgaaaaccatattgaggctgcagtttagc
gaggaaatgcatcgtcaattgaagagacaaagcactagctcaactaagggttccataaaa
ccttccaataagaggtacactgaagctttggagaaactaagtaacctcgaaaaagagcag
tcgaaagaaggagcccgcaccaagattggaaaacttaaaagcaaattgaatgctgtccat
actgcaaacgaaaaatga

DBGET integrated database retrieval system