KEGG   Saccharomyces cerevisiae (budding yeast): YPR058W
Entry
YPR058W           CDS       T00005                                 

Gene name
YMC1
Definition
(RefSeq) organic acid transporter
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPR058W (YMC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YPR058W (YMC1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 856171
NCBI-ProteinID: NP_015383
SGD: S000006262
UniProt: P32331
Position
XVI:673751..674674
AA seq 307 aa
MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT
TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL
PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL
TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL
DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE
LAMRLLG
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtctgaagaatttccatctcctcaactaatcgatgatttggaagaacatccacagcat
gataatgctcgagtcgtgaaagatttgcttgcaggtacagcgggtggtattgcgcaagtg
ctagtgggccagccctttgatacgacaaaagttaggttacaaacatcgagcaccccaaca
acagccatggaagtcgtcagaaagctgcttgccaatgaagggcctcgcgggttttacaaa
ggaactctgacgccattaattggtgttggtgcatgtgtttcattacaatttggtgttaat
gaagctatgaagagattttttcatcatcgcaatgctgatatgtcatcgactttgtcattg
ccacagtattacgcatgtggtgtcacaggcggtatagtaaactcattcttggcgtcccca
attgagcatgtcaggattcgcttgcaaacacagactggctcaggcaccaacgcagaattc
aagggtcctttggaatgcatcaaaaaattaagacataacaaggccttgctacgtggttta
acacctacaatattgagagaaggtcatggatgtggcacatatttcttagtgtatgaagcg
ttgattgctaaccaaatgaacaaaagacgtggactagagagaaaggacattcctgcatgg
aaactttgtatttttggagcattgtctggcactgccttatggttgatggtatatccatta
gatgtcatcaagtctgtcatgcaaacggataatttacaaaagcctaaatttggtaattct
atttccagtgtagccaagactttatatgccaatggagggataggcgcttttttcaaaggg
tttggtcctaccatgctaagagctgctcccgccaatggtgccacttttgctacttttgaa
ttagcgatgaggttattgggttga

DBGET integrated database retrieval system