KEGG   Saccharomyces cerevisiae (budding yeast): YPR061CHelp
Entry
YPR061C           CDS       T00005                                 

Gene name
JID1
Definition
(RefSeq) Jid1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-GeneID: 856174
NCBI-ProteinID: NP_015386
SGD: S000006265
UniProt: Q12350
Position
XVI:complement(675977..676882)
Genome map
AA seq 301 aa AA seqDB search
MLHHKFVYPFLFKWHLSCVEKCPPQITFIAKYATANDKNGNRKLTIRDEQWPELADPTPY
DIFGIPKAGSGNPKLDKKSLKKKYHRYVKLYHPDHSDNIQIFSSEKVTNSDSKSPLLLTS
SEKLHRFKVISQAYDILCDPKKKIVYDTTRQGWTTSYSPRSNVNTENYQYAGSYGYHSNA
QYEYWNAGTWEDANSMKNERIQENINPWTVIGIICGLAICIEGTALLAKIQESLSKAEFT
HDESGLHLIQSYTNYGLDTDKFSRLRRFLWFRTWGLYKSKEDLDREAKINEEMIRKLKAA
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgctacaccataagttcgtatacccatttttattcaagtggcacttatcatgtgtagaa
aagtgtcccccacaaatcacttttatagctaagtatgctacagcgaacgataaaaatggc
aatagaaaacttacgataagggatgaacaatggcctgagttggcagatccaactccctat
gatatttttggcattccaaaggccggatctggaaatcctaaactggacaagaagtcgtta
aaaaaaaaatatcatcgttatgtaaaattgtaccaccctgaccattccgataacattcaa
atatttagctcagaaaaggttaccaacagtgatagtaaatcaccgctgctgctaacatca
agcgaaaaactacatagatttaaagtcatctctcaagcatatgatattctttgtgaccca
aagaaaaagatcgtatatgacacaacgaggcaaggctggaccacatcgtattcaccacgt
tctaacgttaatactgaaaattaccaatatgccggctcttatggctaccactctaacgcg
cagtatgaatactggaacgctgggacttgggaagacgcaaatagcatgaaaaacgaaaga
attcaagaaaacatcaacccatggaccgttattggcataatttgtggcctagctatatgc
atcgaagggactgcgttgttagccaaaatccaggagtctctgagcaaggccgaatttact
catgacgaaagtggattacatttgattcagtcatacacgaattatggtcttgatactgac
aaattttccagattgaggcggttcttatggtttagaacttggggactttacaagtcgaaa
gaggatttagatagagaagccaagatcaatgaagaaatgatacgcaaactgaaagcagct
aaatga

DBGET integrated database retrieval system