KEGG   Saccharomyces cerevisiae (budding yeast): YPR095C
Entry
YPR095C           CDS       T00005                                 

Symbol
SYT1
Name
(RefSeq) Arf family guanine nucleotide exchange factor SYT1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Sec7
Other DBs
NCBI-GeneID: 856210
NCBI-ProteinID: NP_015420
SGD: S000006299
UniProt: Q06836
Position
XVI:complement(721037..724717)
AA seq 1226 aa
MNQSISSLIKLKFLQSHSNDKNGNKKGGSNVSTGIDKLRESESYRSPFLQLAEIQEHTNN
DDDKLDVKECEPTKKHSKLSRIRRKMGRLDLNFRSANEKGSEDDEILVAQHLRNGQDPEE
MPFKSENNIDSIEKVPKPDGERVTLTSSGSDNVKRNSKHAPFIPVKPALEKFPSSNRLSR
DYRKSQEPTLFNGDRLVPTLPTVSRISTSSSVGSSTAASRYFNPSKRAVVASSSSSSSSI
KFNSLHAIPLDATPQIELAKQQDEISKRRFGRRRSRTVDVFDYINKNNTAKNKPPLSPSS
FIRTIDEKNTNSLMQDPMGSRGPLLPDDANIISNDTDGAEASHPDHQVLSRSRSQSTSFV
QGKGGKRKSIEDEGYHNKLGLPHGSGPTSVYNNKSNANSTITGMSRRSSSIVNALSSFVN
LRSSSLSSSRQQHLQQQQQLQQKLDVSLEDLPPVPAPEFSDSCKDFLIKLAPYGKFIGII
LTEKDDEFKKNCLNYLLTNCFEFKNDPLDIALRKLLMFLELPKETQQIDRLIMAFSFAYY
KAQKSYSKKKGIECPWSNADQVYFIAFSLLMLHTDYFNPNNKSKMTKHDFVDLVHNDKYS
GGNEIPMAVLTYFYENVTAKESPKFNYFLMSPMALDDSILDKDAFDTNFAITLSSNSMYS
PIDMIKRGSIIPKEASLSPIFYPLTNSISASGIAPSTAASCPPSTSGTINGANLGTANSN
SNRPASNSISSYFSYNPSSSSSGNATLVQDDINVYSHIINDTLNEVNLFPEVSKYWNKNA
LKANLLRNEEHKYEKYYSIMNDTKGGYLRFHKSQLNKLNLPNFEILNDNSRSGCKNSDYK
YCKILQMGAIMNLGMPSRKFSIVNSAKIHWKKEFAILTSLGLLICDKMDWINPQMMKDPK
SGTTNYIIDFKSGFSFVPGSTIDVYNGLFADRERDSLGKSHFASLVLAYTEHHSTGSHTS
NTTAASSSAKHNEGVFEPSSDEEDSITNSTDGTSSVSNGESDNDSVSSSDNQLSSNDSNE
DYHSIKDEYPIFEDENADCLLYLHTCHRNFIWKCANKYERDNWIDSINLFSAYDGCYVEI
GSIANTICNKRKLTILQRMERLRSIKSAKWEKLKKFESTLMLMGKCVPISTKTKTDMINR
IRQLAVRMDWLIYEIKRSELFVSIIKEVTRKQAEKNILEHGKGEEEGQGNNDDSDGIDDI
EESFLFNENSLQVCVSDSSYDEYSNE
NT seq 3681 nt   +upstreamnt  +downstreamnt
atgaatcagtctatttcttcgttgattaagcttaaattccttcaatcacacagtaacgat
aaaaatggcaacaaaaagggcggaagcaatgtttcaacaggcatagataaattaagagag
tcggaaagttatagaagtccttttcttcaactcgcagaaatacaggaacacactaataat
gacgacgataaacttgatgtaaaagaatgcgagcccacaaaaaaacacagcaaactaagc
aggatacggcgtaagatgggtaggttagacttgaatttcaggtcagccaatgaaaagggt
tctgaagatgatgaaatcttggttgcacaacacctccgtaatggacaagatcctgaagaa
atgcctttcaaatcagaaaacaacatagattcgatagagaaagttcccaagcccgatggt
gagagagtcacgcttactagctccgggtctgataacgtaaagagaaattcaaaacacgcc
ccattcattcctgtgaaacctgctctagaaaaatttccttcttctaatagattgtcaaga
gattacagaaaatcacaagagcctaccctgtttaacggtgatagattagttcctactctt
cctactgtgagtaggatatcgacatcttcttccgtcggttcctctacagcggcttcaaga
tatttcaatccgtccaaaagagctgttgttgcatcatcatcatcatcgtcgtcgtcaata
aaattcaattcgctgcacgcaataccacttgatgcaactcctcaaattgaattggcaaaa
caacaagatgagatctccaaaaggaggttcggaagaaggcgcagtagaactgttgacgta
tttgactatattaacaaaaacaatacagcaaagaacaaaccgccactctctccatcttct
tttattaggactattgacgagaaaaatacaaattctcttatgcaagaccccatgggatcc
cgcggacctcttttgcccgatgatgccaatattataagcaatgatacagatggagcggaa
gcaagtcacccagaccatcaggttttatcaaggtctcgatctcaaagtacgtcttttgtt
caaggcaagggcggcaagagaaaatcaattgaagatgaaggctaccataacaaattgggc
ctacctcatggatcaggccctacttcagtttacaacaataaaagcaatgccaattcaact
attactggaatgtcaagaagaagtagctcaattgtgaatgctttaagtagttttgttaac
cttcgctcctccagtttatcatcctctaggcaacagcaccttcaacaacaacagcagcta
caacaaaaactggatgtctcgctggaagatctaccaccggttcccgcgcctgaatttagt
gattcttgtaaggacttcttgattaaattagcgccctacggaaagttcattgggatcatt
ttaacggaaaaagatgatgagttcaaaaaaaattgtttaaactacctattaacgaattgc
ttcgaatttaaaaatgaccctttagatattgccctgaggaaattgttgatgtttttagag
cttccaaaggagacgcagcaaattgatagattgataatggcttttagctttgcatactat
aaggcccaaaagagctattctaagaaaaaaggaattgagtgcccctggtctaatgcagac
caggtgtattttattgcattttccttactaatgttgcacactgattactttaaccccaac
aataaaagcaaaatgacaaagcatgatttcgtggatttagtccataatgacaaatactca
ggaggtaatgagatccctatggccgttttgacatatttttatgagaatgtgacagccaaa
gagtcgccgaaatttaattactttttgatgtcaccaatggcgttggacgatagcatcctt
gataaagatgcatttgacacaaattttgctatcacattatcttcgaattcgatgtattct
cccatagacatgataaaaagggggagtataatacccaaggaagcttccctttccccaatc
ttttatccgctaacgaattcaattagtgcatctggtattgccccatctacggcggcttct
tgcccaccaagtacgtcgggtactataaacggggccaacctcggaacggctaacagtaat
agcaatagaccggcttctaactcaatatcgtcttatttttcatataatccaagctctagt
tctagcggaaatgctacgttagttcaagatgacattaacgtttattcgcacattataaat
gatacattaaatgaagtaaatctatttccagaagtctcaaaatattggaataagaatgct
ctgaaggcaaatttgttgagaaatgaagaacataaatacgaaaaatattatagtattatg
aatgatactaaaggtgggtatttacgctttcacaaaagtcaattgaataaactgaattta
cctaattttgaaatattgaatgataatagccggtctggatgcaagaactccgattataag
tattgcaaaatccttcaaatgggagcaataatgaatttggggatgcccagtagaaaattt
tctattgttaactccgctaaaattcattggaaaaaggaatttgccatattaacatcattg
gggcttttgatctgcgataaaatggactggataaatccacagatgatgaaggacccaaaa
tcaggaactacaaactatataattgattttaaatcaggattttcttttgttccgggaagt
acgattgacgtgtataacggtttatttgctgatagggagcgagattcacttgggaaatct
catttcgcaagtttggtacttgcgtatacagagcatcattctactgggagtcatacaagc
aacacaactgcagcaagtagctccgccaaacacaatgaaggagtcttcgagccatcttca
gatgaagaggatagcataacgaattctactgatggtacgagcagtgtgagtaacggcgag
agtgacaacgatagtgtttctagttcagataatcaactcagttcaaatgacagtaatgaa
gattatcattccattaaggacgagtatccgattttcgaagacgaaaatgccgattgtcta
ttatacttacatacatgtcatcgaaattttatctggaaatgtgctaataagtatgaaagg
gacaactggatcgattctatcaatctattttcagcatatgacggatgctatgtggaaatt
ggtagtatagcaaacactatttgtaataagagaaagcttaccattttgcagaggatggaa
agacttaggtctataaaatcagccaaatgggagaaattgaaaaaatttgaaagcactctg
atgcttatgggaaaatgtgttcctattagcacaaagactaagacagatatgataaaccgc
ataagacagctggctgtcagaatggactggttaatctacgaaattaagagaagcgagctg
tttgtaagtatcataaaagaagtgactcgcaagcaggctgaaaagaatatcttagagcat
ggtaaaggagaagaggaggggcaaggcaataacgacgatagtgatggtatagatgatata
gaggaaagcttcttattcaacgagaacagtttgcaagtgtgcgtgagcgacagtagttac
gacgaatatagtaacgaataa

DBGET integrated database retrieval system