KEGG   Saccharomyces cerevisiae (budding yeast): YPR108W
Entry
YPR108W           CDS       T00005                                 

Gene name
RPN7
Definition
(RefSeq) proteasome regulatory particle lid subunit RPN7
  KO
K03037  26S proteasome regulatory subunit N7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YPR108W (RPN7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YPR108W (RPN7)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     YPR108W (RPN7)
SSDB
Motif
Pfam: RPN7 PCI TPR_8 TPR_2 TPR_12 TPR_1 DUF5494 DUF1897
Other DBs
NCBI-GeneID: 856223
NCBI-ProteinID: NP_015433
SGD: S000006312
UniProt: Q06103
Structure
PDB: 

Position
XVI:742454..743743
AA seq 429 aa
MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMA
PYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKL
EEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFF
YNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTS
IELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASD
YASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVS
VAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAA
VRLTGSDRV
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggtagacgtggaagagaaaagtcaagaagttgaatatgttgatccaacggtgaatagg
gtgcccaattatgaggtatctgaaaaggcgtttcttttgacacaatcaaaggttagtatt
gaacagcgtaaggaagcggcagagttcgttttagccaaaattaaagaggaagaaatggcc
ccttattataaatatctttgcgaggaataccttgttaataatggccaatctgacttggaa
cacgatgaaaagtcagattctttaaacgaatggatcaaatttgaccaggagctatacaat
gaattgtgcaaaaaaaatgaaagtaagattaaagagttaaatgaaaagatccaaaaattg
gaagaagatgatgaaggtgaactagaacaagctcaagcctggattaatctgggtgaatat
tatgcacaaatcggtgacaaagataatgctgaaaagacgctagggaaatcattatcgaag
gctatttccacaggcgccaaaattgatgttatgctaacaattgcaaggctggggttcttt
tataacgaccaactttatgttaaggagaagttggaagcagtcaattctatgattgaaaaa
ggtggtgactgggagagaagaaatagatataaaacatactatggtatccactgcttggcc
gtaagaaactttaaggaagcggcaaagttattggtcgattctctagcaactttcacctct
attgaattaacttcctatgaaagcattgccacatatgcatcggtcacaggtttattcact
ctggaaagaacagacctaaaatccaaagtcatcgattcacctgaattgttatctttaatc
tcaacaactgccgcactacaatctatctcgtcgttaacaatttccctttacgcgtccgat
tatgccagttactttccatatcttttggaaacatatgcaaatgttttgattccatgtaaa
tatttgaatagacatgcagatttctttgttagagaaatgagaagaaaagtctacgcacaa
ttgttggaatcatataagactttgtcgctgaaatctatggcaagcgcatttggtgtttcg
gttgcgttcttggataacgacctgggtaagtttattccaaataagcaactaaattgtgtc
attgatagagttaatgggatcgtagagaccaacaggccagacaacaaaaatgctcaatac
catctgctagttaagcaaggtgacggtttgctaacaaaattacaaaaatacggtgcagca
gtgagattgacagggtcagatcgtgtttga

DBGET integrated database retrieval system