KEGG   Saccharomyces cerevisiae (budding yeast): YPR119W
Entry
YPR119W           CDS       T00005                                 

Symbol
CLB2
Name
(RefSeq) B-type cyclin CLB2
  KO
K23469  G2/mitotic-specific cyclin 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YPR119W (CLB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YPR119W (CLB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 856236
NCBI-ProteinID: NP_015444
SGD: S000006323
UniProt: P24869
Position
XVI:771653..773128
AA seq 491 aa
MSNPIENTENSQNTSSSRFLRNVQRLALNNVTNTTFQKSNANNPALTNFKSTLNSVKKEG
SRIPQFTRESVSRSTAAQEEKRTLKENGIQLPKNNLLDDKENQDPSSQQFGALTSIKEGR
AELPANISLQESSSAKEIIQHDPLKGVGSSTEVVHNSVENEKLHPARSQLQVRNTESETD
SGKKRPISTIVEQELPKKFKVCDENGKEEYEWEDLDAEDVNDPFMVSEYVNDIFEYLHQL
EVITLPKKEDLYQHRNIHQNRDILVNWLVKIHNKFGLLPETLYLAINIMDRFLGKELVQL
DKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFILKTLKFNLNYPN
PMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGILPSLCAAAAMFMSRKMLGKGKW
DGNLIHYSGGYTKEELAPVCHMIMDYLVSPIVHDEFHRKYQSRRFMKASIISVQWALKVR
KNGYDIMTLHE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtccaacccaatagaaaacacagaaaactcacagaatactagttcatcaaggtttttg
aggaatgtacaaaggttggccttaaacaatgtaacaaatacgacatttcaaaagagtaat
gcgaataatccagccctaacaaatttcaaatctacactaaactcagtaaagaaggaggga
agtcggattcctcaatttactagagaaagcgtatcaagatcaacagccgcacaagaggag
aaaagaaccctgaaagaaaatggtatccaactccccaaaaacaatcttttagatgataaa
gaaaaccaagacccaagtagtcagcaatttggtgcgctaacttctataaaggaggggaga
gctgagctgcctgcaaatataagtttacaagaatcctcctcagcgaaggagataatccag
catgatcccctaaaaggcgttggatcaagcactgaggtagtccataactcggtagaaaac
gaaaaacttcatccagctagaagtcaacttcaagttagaaataccgaaagtgaaactgat
agtggaaaaaaaagaccaatttctacaattgttgaacaagaactgcccaaaaagtttaaa
gtgtgcgatgaaaatggcaaagaagaatatgaatgggaagacctagatgcagaagatgta
aatgatccattcatggtcagcgagtacgtcaatgatatattcgaatatctccaccaacta
gaggtcattactcttccaaagaaggaagatctctatcagcatagaaatattcatcaaaat
cgagatatcctagttaattggttggttaaaatccataataaattcggcttattaccggag
actttgtatcttgccattaacataatggacaggtttttaggtaaagagctagttcaactg
gataagttacaattggttggcacatcatgccttttcattgcctctaaatatgaagaggtc
tattctcctagtataaaacatttcgcatcagagacagacggtgcatgtacggaagatgaa
atcaaagaaggggagaaattcattttaaagacattgaaatttaacctaaattatcccaat
ccgatgaattttctgagaagaatttcgaaagcagatgactacgatatacagtctcgaact
cttgccaaattcttattagagatatcattggtagatttcagatttattgggatactaccc
tcattgtgtgcagcagctgcgatgtttatgtcgagaaaaatgttaggtaaaggtaaatgg
gatggaaatctaatacactatagcggcgggtatactaaagaagaacttgcgcccgtgtgt
cacatgataatggattatctagtgagtccaattgttcatgatgaatttcatagaaaatat
caatctagaagatttatgaaagcttctataatttccgtccaatgggctttaaaggttaga
aaaaacggctatgatataatgaccttgcatgaatga

DBGET integrated database retrieval system